Lipid II flippase FtsW (ftsW) Recombinant Protein | ftsW recombinant protein
Recombinant Lactococcus lactis subsp. cremoris Lipid II flippase FtsW (ftsW)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipid II flippase FtsW (ftsW); Recombinant Lactococcus lactis subsp. cremoris Lipid II flippase FtsW (ftsW); Recombinant Lipid II flippase FtsW (ftsW); Lipid II flippase FtsW; Cell division protein FtsW; ftsW recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-198
Sequence
MNLNKNNFLNYSILIPYLILAGIGIVMIFSTTVPDQLQKGLNPYKLVINQTAFVLLSIIMIAVIYRLKLRALKNRKMIGIIMVILILSLIFCRIMPSSFALTAPVNGARGWIHIPGIGTVQPAEFAKVFIIWYLASVFSTKQEEIEKNDINEIFKGKTLTQKLFGGWRLPVVAILLVDLIMPDLGNTMIIGAVALIMI
Sequence Length
198
Species
Lactococcus lactis subsp. cremoris (Streptococcus cremoris)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
UniProt Accession #
Molecular Weight
22,102 Da
NCBI Official Full Name
Lipid II flippase FtsW
UniProt Protein Name
Lipid II flippase FtsW
Protein Family
UniProt Gene Name
ftsW
UniProt Entry Name
FTSW_LACLC
Uniprot Description
Function: Essential cell division protein. Transports lipid-linked peptidoglycan precursors from the inner to the outer leaflet of the cytoplasmic membrane
By similarity.
Subcellular location: Cell membrane; Multi-pass membrane protein
By similarity. Note: Localizes to the division septum
By similarity.
Sequence similarities: Belongs to the SEDS family. FtsW subfamily.
Similar Products
Product Notes
The Lipid II flippase FtsW (ftsW) ftsw (Catalog #AAA1066419) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-198. The amino acid sequence is listed below: MNLNKNNFLN YSILIPYLIL AGIGIVMIFS TTVPDQLQKG LNPYKLVINQ TAFVLLSIIM IAVIYRLKLR ALKNRKMIGI IMVILILSLI FCRIMPSSFA LTAPVNGARG WIHIPGIGTV QPAEFAKVFI IWYLASVFST KQEEIEKNDI NEIFKGKTLT QKLFGGWRLP VVAILLVDLI MPDLGNTMII GAVALIMI. It is sometimes possible for the material contained within the vial of "Lipid II flippase FtsW (ftsW), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
