Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NEK6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Rabbit NEK6 Polyclonal Antibody | anti-NEK6 antibody

NEK6 antibody - N-terminal region

Gene Names
NEK6; SID6-1512
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NEK6; Polyclonal Antibody; NEK6 antibody - N-terminal region; anti-NEK6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR
Sequence Length
313
Applicable Applications for anti-NEK6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NEK6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NEK6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-NEK6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Related Product Information for anti-NEK6 antibody
This is a rabbit polyclonal antibody against NEK6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.The Aspergillus nidulans 'never in mitosis A' (NIMA) gene encodes a serine/threonine kinase that controls initiation of mitosis. NIMA-related kinases (NEKs) are a group of protein kinases that are homologous to NIMA. Evidence suggests that NEKs perform functions similar to those of NIMA.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-NEK6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
serine/threonine-protein kinase Nek6 isoform 2
NCBI Official Synonym Full Names
NIMA related kinase 6
NCBI Official Symbol
NEK6
NCBI Official Synonym Symbols
SID6-1512
NCBI Protein Information
serine/threonine-protein kinase Nek6
UniProt Protein Name
Serine/threonine-protein kinase Nek6
UniProt Gene Name
NEK6
UniProt Synonym Gene Names
NimA-related protein kinase 6
UniProt Entry Name
NEK6_HUMAN

NCBI Description

The protein encoded by this gene is a kinase required for progression through the metaphase portion of mitosis. Inhibition of the encoded protein can lead to apoptosis. This protein also can enhance tumorigenesis by suppressing tumor cell senescence. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

NEK6: a protein kinase of the NEK family. Important in mitosis. May regulate spindle function.

Protein type: Protein kinase, Other; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; Other group; NEK family

Chromosomal Location of Human Ortholog: 9q33.3-q34.11

Cellular Component: spindle pole; microtubule; cytoplasm; microtubule organizing center; nuclear speck; cytosol; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; signal transducer activity; kinesin binding; magnesium ion binding; protein kinase binding; ATP binding

Biological Process: mitosis; positive regulation of I-kappaB kinase/NF-kappaB cascade; apoptosis; protein amino acid autophosphorylation; regulation of mitotic cell cycle; regulation of mitotic metaphase/anaphase transition; mitotic nuclear envelope disassembly; cytokinesis; spindle assembly; signal transduction; protein amino acid phosphorylation; chromosome segregation; peptidyl-serine phosphorylation; mitotic cell cycle; G2/M transition DNA damage checkpoint

Research Articles on NEK6

Similar Products

Product Notes

The NEK6 nek6 (Catalog #AAA3209154) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NEK6 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NEK6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NEK6 nek6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FRCSLADFQI EKKIGRGQFS EVYKATCLLD RKTVALKKVQ IFEMMDAKAR. It is sometimes possible for the material contained within the vial of "NEK6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.