Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ATP-dependent zinc metalloprotease FtsH (ftsH) Recombinant Protein | ftsH recombinant protein

Recombinant Hahella chejuensis ATP-dependent zinc metalloprotease FtsH (ftsH)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-dependent zinc metalloprotease FtsH (ftsH); Recombinant Hahella chejuensis ATP-dependent zinc metalloprotease FtsH (ftsH); ftsH recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-619aa; full length protein
Sequence
MSNTDPQPPQKLPLNWVVWTLAVALMLYYLPAMRDRPEPAIKLPYSEFRMLLREGQISSV TLRGSELDGKFITPRMFPEQRRQYSRFLTQLPDFGNEAILAELEEQNIPLEVKEGHDASS SKVILLSYLPWIMFMIILFWLSRRTFRNFSGRGGAFDFDKRLETQFECQKPDTTFDEVAG QTNAKREVQELVEYLRDPDRFHRVGALAPRGVLLMGPPGTGKTLLARALAGEAGVNFYPM SASEFIEVFVGVGASRVRQLFKIAKENSPSIIFIDELDSVGRTRGAGYGGGHDEREQTLN QILAEMDGFAGHDAVIVLAATNRPDVLDPALMRPGRFDRHVTLDLPDQEGRVAILKVHAR HIPLADDVNLNQVAAGTPGFSGADLKNLINEAAIQAARENRDHVHSLDFDIARDKIIMGA ERTLIIPPDEKHRLAVHESGHTLVAYYLPNTDPLYKVSIVPHGRSLGGTHQLPLQERHTY PEEYLRDKLAVMLAGRIAERELLGSVSTGADDDIHQATGLARAMVSRWGMSKEVGPVDLR DSEEHPFLGREMAQPHHHSEFSAEIIDKAVRELLVAAETTAADLISTHREKLDRLVALLE RSETLHKAQIDECLQTGAS
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Hahella chejuensis (strain KCTC 2396)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ftsH recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69,164 Da
NCBI Official Full Name
ATP-dependent zinc metalloprotease FtsH
UniProt Protein Name
ATP-dependent zinc metalloprotease FtsH
UniProt Gene Name
ftsH
UniProt Entry Name
FTSH_HAHCH

Uniprot Description

Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins.

Similar Products

Product Notes

The ftsH ftsh (Catalog #AAA7015244) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-619aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ftsH ftsh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSNTDPQPPQ KLPLNWVVWT LAVALMLYYL PAMRDRPEPA IKLPYSEFRM LLREGQISSV TLRGSELDGK FITPRMFPEQ RRQYSRFLTQ LPDFGNEAIL AELEEQNIPL EVKEGHDASS SKVILLSYLP WIMFMIILFW LSRRTFRNFS GRGGAFDFDK RLETQFECQK PDTTFDEVAG QTNAKREVQE LVEYLRDPDR FHRVGALAPR GVLLMGPPGT GKTLLARALA GEAGVNFYPM SASEFIEVFV GVGASRVRQL FKIAKENSPS IIFIDELDSV GRTRGAGYGG GHDEREQTLN QILAEMDGFA GHDAVIVLAA TNRPDVLDPA LMRPGRFDRH VTLDLPDQEG RVAILKVHAR HIPLADDVNL NQVAAGTPGF SGADLKNLIN EAAIQAAREN RDHVHSLDFD IARDKIIMGA ERTLIIPPDE KHRLAVHESG HTLVAYYLPN TDPLYKVSIV PHGRSLGGTH QLPLQERHTY PEEYLRDKLA VMLAGRIAER ELLGSVSTGA DDDIHQATGL ARAMVSRWGM SKEVGPVDLR DSEEHPFLGR EMAQPHHHSE FSAEIIDKAV RELLVAAETT AADLISTHRE KLDRLVALLE RSETLHKAQI DECLQTGAS. It is sometimes possible for the material contained within the vial of "ATP-dependent zinc metalloprotease FtsH (ftsH), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.