Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Ferric/cupric reductase transmembrane component 1 (FRE1) Recombinant Protein | FRE1 recombinant protein

Recombinant Saccharomyces cerevisiae Ferric/cupric reductase transmembrane component 1 (FRE1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ferric/cupric reductase transmembrane component 1 (FRE1); Recombinant Saccharomyces cerevisiae Ferric/cupric reductase transmembrane component 1 (FRE1); FRE1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-686aa; full length protein
Sequence
TLISTSCISQAALYQFGCSSKSKSCYCKNINWLGSVTACAYENSKSNKTLDSALMKLASQ CSSIKVYTLEDMKNIYLNASNYLRAPEKSDKKTVVSQPLMANETAYHYYYEENYGIHLNL MRSQWCAWGLVFFWVAVLTAATILNILKRVFGKNIMANSVKKSLIYPSVYKDYNERTFYL WKRLPFNFTTRGKGLVVLIFVILTILSLSFGHNIKLPHPYDRPRWRRSMAFVSRRADLMA IALFPVVYLFGIRNNPFIPITGLSFSTFNFYHKWSAYVCFMLAVVHSIVMTASGVKRGVF QSLVRKFYFRWGIVATILMSIIIFQSEKVFRNRGYEIFLLIHKAMNIMFIIAMYYHCHTL GWMGWIWSMAGILCFDRFCRIVRIIMNGGLKTATLSTTDDSNVIKISVKKPKFFKYQVGA FAYMYFLSPKSAWFYSFQSHPFTVLSERHRDPNNPDQLTMYVKANKGITRVLLSKVLSAP NHTVDCKIFLEGPYGVTVPHIAKLKRNLVGVAAGLGVAAIYPHFVECLRLPSTDQLQHKF YWIVNDLSHLKWFENELQWLKEKSCEVSVIYTGSSVEDTNSDESTKGFDDKEESEITVEC LNKRPDLKELVRSEIKLSELENNNITFYSCGPATFNDDFRNAVVQGIDSSLKIDVELEEE SFTW
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for FRE1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78,854 Da
NCBI Official Full Name
ferric/cupric-chelate reductase
NCBI Official Symbol
FRE1
NCBI Protein Information
ferric/cupric-chelate reductase
UniProt Protein Name
Ferric/cupric reductase transmembrane component 1
UniProt Gene Name
FRE1
UniProt Entry Name
FRE1_YEAST

Uniprot Description

Metalloreductase responsible for reducing extracellular iron and copper prior to import. Catalyzes the reductive uptake of Fe3+-salts and Fe3+ bound to catecholate or hydroxamate siderophores. Fe3+ is reduced to Fe2+, which then dissociates from the siderophore and can be imported by the high-affinity Fe2+ transport complex in the plasma membrane. Also participates in Cu2+ reduction and Cu+ uptake.

Research Articles on FRE1

Similar Products

Product Notes

The FRE1 fre1 (Catalog #AAA7015168) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-686aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the FRE1 fre1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TLISTSCISQ AALYQFGCSS KSKSCYCKNI NWLGSVTACA YENSKSNKTL DSALMKLASQ CSSIKVYTLE DMKNIYLNAS NYLRAPEKSD KKTVVSQPLM ANETAYHYYY EENYGIHLNL MRSQWCAWGL VFFWVAVLTA ATILNILKRV FGKNIMANSV KKSLIYPSVY KDYNERTFYL WKRLPFNFTT RGKGLVVLIF VILTILSLSF GHNIKLPHPY DRPRWRRSMA FVSRRADLMA IALFPVVYLF GIRNNPFIPI TGLSFSTFNF YHKWSAYVCF MLAVVHSIVM TASGVKRGVF QSLVRKFYFR WGIVATILMS IIIFQSEKVF RNRGYEIFLL IHKAMNIMFI IAMYYHCHTL GWMGWIWSMA GILCFDRFCR IVRIIMNGGL KTATLSTTDD SNVIKISVKK PKFFKYQVGA FAYMYFLSPK SAWFYSFQSH PFTVLSERHR DPNNPDQLTM YVKANKGITR VLLSKVLSAP NHTVDCKIFL EGPYGVTVPH IAKLKRNLVG VAAGLGVAAI YPHFVECLRL PSTDQLQHKF YWIVNDLSHL KWFENELQWL KEKSCEVSVI YTGSSVEDTN SDESTKGFDD KEESEITVEC LNKRPDLKEL VRSEIKLSEL ENNNITFYSC GPATFNDDFR NAVVQGIDSS LKIDVELEEE SFTW. It is sometimes possible for the material contained within the vial of "Ferric/cupric reductase transmembrane component 1 (FRE1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.