Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Glutamate carboxypeptidase 2 (FOLH1) Recombinant Protein | FOLH1 recombinant protein

Recombinant Human Glutamate carboxypeptidase 2 (FOLH1), partial

Gene Names
FOLH1; PSM; FGCP; FOLH; GCP2; PSMA; mGCP; GCPII; NAALAD1; NAALAdase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glutamate carboxypeptidase 2 (FOLH1); Recombinant Human Glutamate carboxypeptidase 2 (FOLH1); partial; FOLH1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
48-750aa; Partial
Sequence
EATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for FOLH1 recombinant protein
This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,090 Da
NCBI Official Full Name
glutamate carboxypeptidase 2 isoform 2
NCBI Official Synonym Full Names
folate hydrolase 1
NCBI Official Symbol
FOLH1
NCBI Official Synonym Symbols
PSM; FGCP; FOLH; GCP2; PSMA; mGCP; GCPII; NAALAD1; NAALAdase
NCBI Protein Information
glutamate carboxypeptidase 2
UniProt Protein Name
Glutamate carboxypeptidase 2
UniProt Gene Name
FOLH1
UniProt Synonym Gene Names
FOLH; NAALAD1; PSM; PSMA; FGCP; GCPII; mGCP; NAALADase I; PSM; PSMA

NCBI Description

This gene encodes a type II transmembrane glycoprotein belonging to the M28 peptidase family. The protein acts as a glutamate carboxypeptidase on different alternative substrates, including the nutrient folate and the neuropeptide N-acetyl-l-aspartyl-l-glutamate and is expressed in a number of tissues such as prostate, central and peripheral nervous system and kidney. A mutation in this gene may be associated with impaired intestinal absorption of dietary folates, resulting in low blood folate levels and consequent hyperhomocysteinemia. Expression of this protein in the brain may be involved in a number of pathological conditions associated with glutamate excitotoxicity. In the prostate the protein is up-regulated in cancerous cells and is used as an effective diagnostic and prognostic indicator of prostate cancer. This gene likely arose from a duplication event of a nearby chromosomal region. Alternative splicing gives rise to multiple transcript variants encoding several different isoforms. [provided by RefSeq, Jul 2010]

Uniprot Description

Has both folate hydrolase and N-acetylated-alpha-linked-acidic dipeptidase (NAALADase) activity. Has a preference for tri-alpha-glutamate peptides. In the intestine, required for the uptake of folate. In the brain, modulates excitatory neurotransmission through the hydrolysis of the neuropeptide, N-aceylaspartylglutamate (NAAG), thereby releasing glutamate. Involved in prostate tumor progression.

Research Articles on FOLH1

Similar Products

Product Notes

The FOLH1 folh1 (Catalog #AAA954203) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 48-750aa; Partial. The amino acid sequence is listed below: EATNITPKHN MKAFLDELKA ENIKKFLYNF TQIPHLAGTE QNFQLAKQIQ SQWKEFGLDS VELAHYDVLL SYPNKTHPNY ISIINEDGNE IFNTSLFEPP PPGYENVSDI VPPFSAFSPQ GMPEGDLVYV NYARTEDFFK LERDMKINCS GKIVIARYGK VFRGNKVKNA QLAGAKGVIL YSDPADYFAP GVKSYPDGWN LPGGGVQRGN ILNLNGAGDP LTPGYPANEY AYRRGIAEAV GLPSIPVHPI GYYDAQKLLE KMGGSAPPDS SWRGSLKVPY NVGPGFTGNF STQKVKMHIH STNEVTRIYN VIGTLRGAVE PDRYVILGGH RDSWVFGGID PQSGAAVVHE IVRSFGTLKK EGWRPRRTIL FASWDAEEFG LLGSTEWAEE NSRLLQERGV AYINADSSIE GNYTLRVDCT PLMYSLVHNL TKELKSPDEG FEGKSLYESW TKKSPSPEFS GMPRISKLGS GNDFEVFFQR LGIASGRARY TKNWETNKFS GYPLYHSVYE TYELVEKFYD PMFKYHLTVA QVRGGMVFEL ANSIVLPFDC RDYAVVLRKY ADKIYSISMK HPQEMKTYSV SFDSLFSAVK NFTEIASKFS ERLQDFDKSN PIVLRMMNDQ LMFLERAFID PLGLPDRPFY RHVIYAPSSH NKYAGESFPG IYDALFDIES KVDPSKAWGE VKRQIYVAAF TVQAAAETLS EVA . It is sometimes possible for the material contained within the vial of "Glutamate carboxypeptidase 2 (FOLH1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.