Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Riboflavin transporter FmnP (fmnP) Recombinant Protein | fmnP recombinant protein

Recombinant Bacillus subtilis Riboflavin transporter FmnP (fmnP)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Riboflavin transporter FmnP (fmnP); Recombinant Bacillus subtilis Riboflavin transporter FmnP (fmnP); fmnP recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-190
Sequence
MKVKKLVVVSMLSSIAFVLMLLNFPFPGLPDYLKIDFSDVPAIIAILIYGPLAGIAVEAIKNVLQYIIQGSMAGVPVGQVANFIAGTLFILPTAFLFKKLNSAKGLAVSLLLGTAAMTILMSILNYVLILPAYTWFLHSPALSDSALKTAVVAGILPFNMIKGIVITVVFSLIFIKLKPWIEQQRSAHIH
Sequence Length
190
Species
Bacillus subtilis (strain 168)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for fmnP recombinant protein
fmnP; ribU, ypaA

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,553 Da
NCBI Official Full Name
FMN permease
NCBI Official Symbol
fmnP
NCBI Protein Information
FMN permease
UniProt Protein Name
Riboflavin transporter FmnP
Protein Family
UniProt Gene Name
fmnP
UniProt Synonym Gene Names
ribU; ypaA
UniProt Entry Name
FMNP_BACSU

Uniprot Description

Function: Mediates uptake of riboflavin and roseoflavin, a toxic riboflavin analog; may also transport FMN. Probably a riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transporters this ECF transporter provides the energy necessary to transport a number of different substrates. The substrates themselves are bound by transmembrane, not extracytoplasmic soluble proteins

By similarity. Ref.3

Enzyme regulation: Inhibited by excess of riboflavin or FMN. Also inhibited by protonophores such as CCCP and FCCP or in the absence of glucose. Ref.3

Subunit structure: Forms a stable energy-coupling factor (ECF) transporter complex composed of a membrane-embedded substrate-binding protein (S component), two ATP-binding proteins (A and A' components) and a transmembrane protein (T component)

By similarity. Ref.4

Subcellular location: Cell membrane; Multi-pass membrane protein Ref.3.

Induction: Induced by riboflavin deficiency. Ref.3

Disruption phenotype: Abolishes riboflavin uptake, cell growth less inhibited by roseoflavin. Ref.4

Sequence similarities: Belongs to the prokaryotic riboflavin transporter (P-RFT) (TC 2.A.87) family. [View classification]

Research Articles on fmnP

Similar Products

Product Notes

The fmnP fmnp (Catalog #AAA1091517) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-190. The amino acid sequence is listed below: MKVKKLVVVS MLSSIAFVLM LLNFPFPGLP DYLKIDFSDV PAIIAILIYG PLAGIAVEAI KNVLQYIIQG SMAGVPVGQV ANFIAGTLFI LPTAFLFKKL NSAKGLAVSL LLGTAAMTIL MSILNYVLIL PAYTWFLHSP ALSDSALKTA VVAGILPFNM IKGIVITVVF SLIFIKLKPW IEQQRSAHIH. It is sometimes possible for the material contained within the vial of "Riboflavin transporter FmnP (fmnP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.