Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Calcium channel flower (flower) Recombinant Protein | DgriGH14474 recombinant protein

Recombinant Drosophila grimshawi Calcium channel flower (flower)

Gene Names
DgriGH14474; dgri_GLEANR_14351; GH14474
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Calcium channel flower (flower); Recombinant Drosophila grimshawi Calcium channel flower (flower); Recombinant Calcium channel flower (flower); Calcium channel flower; DgriGH14474 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-196
Sequence
MSFAEKITGLLARPNQDPAGGPEAPWYLKYGSRVLGIVAAFFAILFGLWNVLSIIGLSVSCLVAGIIQMLAGFVVMALEAPCCFVCIEQVGSVADKVDAKPMYFRAGLYCAMAVPPIFMCFGLASLFGSGLIFATGAVYGMMALGKKASATDMRAAAQQSGYGGNATTSTTNDRAGIVNNAQPFSFTGAVGTDSNV
Sequence Length
196
Species
Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,338 Da
NCBI Official Full Name
GH14474
NCBI Official Symbol
DgriGH14474
NCBI Official Synonym Symbols
dgri_GLEANR_14351; GH14474
NCBI Protein Information
GH14474 gene product from transcript GH14474-RA; DgriGH14474-PA
UniProt Protein Name
Calcium channel flower
UniProt Gene Name
flower
UniProt Entry Name
FLOWR_DROGR

Uniprot Description

Function: A calcium channel that regulates synaptic endocytosis and hence couples exo- with endocytosis. Required in the nervous system and necessary in photoreceptor cells

By similarity. UniProtKB Q95T12

Subunit structure: Homomultimer

By similarity. UniProtKB Q95T12

Subcellular location: Cytoplasmic vesicle › secretory vesicle › synaptic vesicle membrane; Multi-pass membrane protein

By similarity. Note: Upon fusion of the synaptic vesicle with the presynaptic membrane, protein is present in the periactive zones, where endocytosis is known to occur

By similarity. UniProtKB Q95T12

Sequence similarities: Belongs to the calcium channel flower family.

Sequence caution: The sequence EDV97836.1 differs from that shown. Reason: Erroneous gene model prediction.

Similar Products

Product Notes

The DgriGH14474 flower (Catalog #AAA1201009) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-196. The amino acid sequence is listed below: MSFAEKITGL LARPNQDPAG GPEAPWYLKY GSRVLGIVAA FFAILFGLWN VLSIIGLSVS CLVAGIIQML AGFVVMALEA PCCFVCIEQV GSVADKVDAK PMYFRAGLYC AMAVPPIFMC FGLASLFGSG LIFATGAVYG MMALGKKASA TDMRAAAQQS GYGGNATTST TNDRAGIVNN AQPFSFTGAV GTDSNV. It is sometimes possible for the material contained within the vial of "Calcium channel flower (flower), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.