Peptidyl-prolyl cis-trans isomerase FKBP7 (Fkbp7) Recombinant Protein | Fkbp7 recombinant protein
Recombinant Mouse Peptidyl-prolyl cis-trans isomerase FKBP7 (Fkbp7)
Gene Names
Fkbp7; 23kDa; FKBP-7; FKBP23
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peptidyl-prolyl cis-trans isomerase FKBP7 (Fkbp7); Recombinant Mouse Peptidyl-prolyl cis-trans isomerase FKBP7 (Fkbp7); Fkbp7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-218, Full length protein
Sequence
QGQTKEESTEEVKIEVLHRPENCSKTSRKGDLLNAHYDGYLAKDGSKFYCSRTQDEGHPKWFVLGVGHVIKGLDIAMMDMCPGEKRKVIIPPSFAYGKEGYAEGKIPPNATLMFEIELYAVTKGPRSIETFKQIDTDNDRQLSKAEIELYLQKDFEKDANPRDKSYQKAVLEDIFKKNDHNGDGFISPKEYNVHQHDEL
Sequence Length
199
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Fkbp7 recombinant protein
This protein belongs to the FKBP-type peptidyl-prolyl cis
trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. A similar protein in mouse is located in the endoplasmic reticulum and binds calcium.
trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. A similar protein in mouse is located in the endoplasmic reticulum and binds calcium.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,913 Da
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP7 isoform 1
NCBI Official Synonym Full Names
FK506 binding protein 7
NCBI Official Symbol
Fkbp7
NCBI Official Synonym Symbols
23kDa; FKBP-7; FKBP23
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP7
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP7
Protein Family
UniProt Gene Name
Fkbp7
UniProt Synonym Gene Names
Fkbp23; PPIase FKBP7; 23 kDa FKBP; FKBP-23; FKBP-7
Uniprot Description
PPIases accelerate the folding of proteins during protein synthesis.
Research Articles on Fkbp7
Similar Products
Product Notes
The Fkbp7 fkbp7 (Catalog #AAA1011132) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-218, Full length protein. The amino acid sequence is listed below: QGQTKEESTE EVKIEVLHRP ENCSKTSRKG DLLNAHYDGY LAKDGSKFYC SRTQDEGHPK WFVLGVGHVI KGLDIAMMDM CPGEKRKVII PPSFAYGKEG YAEGKIPPNA TLMFEIELYA VTKGPRSIET FKQIDTDNDR QLSKAEIELY LQKDFEKDAN PRDKSYQKAV LEDIFKKNDH NGDGFISPKE YNVHQHDEL. It is sometimes possible for the material contained within the vial of "Peptidyl-prolyl cis-trans isomerase FKBP7 (Fkbp7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
