Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Peptidyl-prolyl cis-trans isomerase FKBP3 Recombinant Protein | FKBP3 recombinant protein

Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP3

Gene Names
FKBP3; FKBP-3; FKBP25; PPIase; FKBP-25
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peptidyl-prolyl cis-trans isomerase FKBP3; Recombinant Human Peptidyl-prolyl cis-trans isomerase FKBP3; 25 kDa FK506-binding protein; 25 kDa FKBP; FKBP-25; FK506-binding protein 3; FKBP-3; Immunophilin FKBP25; Rapamycin-selective 25 kDa immunophilin; Rotamase; FKBP3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-224aa; Full Length
Sequence
AAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Sequence Length
224
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for FKBP3 recombinant protein
FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. PPIases accelerate the folding of proteins.
Product Categories/Family for FKBP3 recombinant protein
References
Isolation of a human cDNA encoding a 25 kDa FK-506 and rapamycin binding protein.Wiederrecht G., Martin M., Sigal N., Siekierka J.J.Biochem. Biophys. Res. Commun. 185:298-303(1992)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41 kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP3
NCBI Official Synonym Full Names
FK506 binding protein 3
NCBI Official Symbol
FKBP3
NCBI Official Synonym Symbols
FKBP-3; FKBP25; PPIase; FKBP-25
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP3
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP3
UniProt Gene Name
FKBP3
UniProt Synonym Gene Names
FKBP25; PPIase FKBP3; 25 kDa FKBP; FKBP-25; FKBP-3
UniProt Entry Name
FKBP3_HUMAN

NCBI Description

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. [provided by RefSeq, Sep 2008]

Uniprot Description

FKBP3: FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct cytoplasmic signal transmission pathways. PPIases accelerate the folding of proteins. Belongs to the FKBP-type PPIase family.

Protein type: EC 5.2.1.8; Isomerase

Chromosomal Location of Human Ortholog: 14q21.2

Cellular Component: endoplasmic reticulum membrane; nucleus

Molecular Function: FK506 binding; peptidyl-prolyl cis-trans isomerase activity; protein binding; receptor activity

Biological Process: protein peptidyl-prolyl isomerization

Research Articles on FKBP3

Similar Products

Product Notes

The FKBP3 fkbp3 (Catalog #AAA969523) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-224aa; Full Length. The amino acid sequence is listed below: AAAVPQRAWT VEQLRSEQLP KKDIIKFLQE HGSDSFLAEH KLLGNIKNVA KTANKDHLVT AYNHLFETKR FKGTESISKV SEQVKNVKLN EDKPKETKSE ETLDEGPPKY TKSVLKKGDK TNFPKKGDVV HCWYTGTLQD GTVFDTNIQT SAKKKKNAKP LSFKVGVGKV IRGWDEALLT MSKGEKARLE IEPEWAYGKK GQPDAKIPPN AKLTFEVELV DID. It is sometimes possible for the material contained within the vial of "Peptidyl-prolyl cis-trans isomerase FKBP3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.