Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Peptidyl-prolyl cis-trans isomerase FKBP1A (Fkbp1a) Recombinant Protein | Fkbp1a recombinant protein

Recombinant Rat Peptidyl-prolyl cis-trans isomerase FKBP1A (Fkbp1a)

Gene Names
Fkbp1a; Fkbp2; FKBP12
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Peptidyl-prolyl cis-trans isomerase FKBP1A (Fkbp1a); Recombinant Rat Peptidyl-prolyl cis-trans isomerase FKBP1A (Fkbp1a); Fkbp1a recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-108, full length protein
Sequence
GVQVETISSGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Sequence Length
107
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Fkbp1a recombinant protein
This protein is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium. Multiple alternatively spliced variants, encoding the same protein, have been identified. The human genome contains five pseudogenes related to this gene, at least one of which is transcribed.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,923 Da
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP1A
NCBI Official Synonym Full Names
FK506 binding protein 1a
NCBI Official Symbol
Fkbp1a
NCBI Official Synonym Symbols
Fkbp2; FKBP12
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP1A
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP1A
UniProt Gene Name
Fkbp1a
UniProt Synonym Gene Names
Fkbp1; PPIase FKBP1A; 12 kDa FKBP; FKBP-12; FKBP-1A

NCBI Description

mediates islet microsome Ca2+ release through binding to ryanodine receptor (RyR) and catalyzes the cis-trans isomerization of peptidyl-prolyl amide peptide bonds [RGD, Feb 2006]

Uniprot Description

Keeps in an inactive conformation TGFBR1, the TGF-beta type I serine/threonine kinase receptor, preventing TGF-beta receptor activation in absence of ligand. Recruits SMAD7 to ACVR1B which prevents the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. May modulate the RYR1 calcium channel activity. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides ().

Research Articles on Fkbp1a

Similar Products

Product Notes

The Fkbp1a fkbp1a (Catalog #AAA1426289) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-108, full length protein. The amino acid sequence is listed below: GVQVETISSG DGRTFPKRGQ TCVVHYTGML EDGKKFDSSR DRNKPFKFTL GKQEVIRGWE EGVAQMSVGQ RAKLIISPDY AYGATGHPGI IPPHATLVFD VELLKLE. It is sometimes possible for the material contained within the vial of "Peptidyl-prolyl cis-trans isomerase FKBP1A (Fkbp1a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.