Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Fat storage-inducing transmembrane protein 1 (FITM1) Recombinant Protein | FITM1 recombinant protein

Recombinant Bovine Fat storage-inducing transmembrane protein 1 (FITM1)

Gene Names
FITM1; FIT1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fat storage-inducing transmembrane protein 1 (FITM1); Recombinant Bovine Fat storage-inducing transmembrane protein 1 (FITM1); Recombinant Fat storage-inducing transmembrane protein 1 (FITM1); Fat storage-inducing transmembrane protein 1; Fat-inducing protein 1; FITM1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-292
Sequence
MERGPVVGAGRGAGARIRALLGGLVRVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWLAAVVIFGPLLQFHVNPRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLATRRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRGYTVSSHTFLLTFCCLLMAEEAAVFAKYLAHGLPAGAPLRLVFLLNVLLLGLWNFLLLCTVIYFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSIHKHN
Sequence Length
292
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,253 Da
NCBI Official Full Name
fat storage-inducing transmembrane protein 1
NCBI Official Synonym Full Names
fat storage-inducing transmembrane protein 1<
NCBI Official Symbol
FITM1
NCBI Official Synonym Symbols
FIT1
NCBI Protein Information
fat storage-inducing transmembrane protein 1; fat-inducing protein 1; fat-inducing transcript 1
UniProt Protein Name
Fat storage-inducing transmembrane protein 1
UniProt Gene Name
FITM1
UniProt Synonym Gene Names
FIT1
UniProt Entry Name
FITM1_BOVIN

Uniprot Description

Function: Plays an important role in lipid droplet accumulation

By similarity.

Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein

By similarity.

Sequence similarities: Belongs to the FIT family.

Similar Products

Product Notes

The FITM1 fitm1 (Catalog #AAA1239571) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-292. The amino acid sequence is listed below: MERGPVVGAG RGAGARIRAL LGGLVRVLLW VASALLYFGS EQAARLLGSP CLRRLYHAWL AAVVIFGPLL QFHVNPRTIF ASHGNFFNIK FVNSAWGWTC TFLGGFVLLV VFLATRRVAV TARHLSRLVV GAAVWRGAGR AFLLIEDLTG SCFEPLPQGL LLHELPDRRS CLAAGHQWRG YTVSSHTFLL TFCCLLMAEE AAVFAKYLAH GLPAGAPLRL VFLLNVLLLG LWNFLLLCTV IYFHQYTHKV VGAAVGTFAW YLTYGSWYHQ PWSPGSPGHG LFPRPHSIHK HN. It is sometimes possible for the material contained within the vial of "Fat storage-inducing transmembrane protein 1 (FITM1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.