Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM (FIE) Recombinant Protein | FIE recombinant protein

Recombinant Arabidopsis thaliana Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM (FIE)

Gene Names
FIE; FERTILIZATION-INDEPENDENT ENDOSPERM; FERTILIZATION-INDEPENDENT ENDOSPERM 1; FIE1; FIS3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM (FIE); Recombinant Arabidopsis thaliana Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM (FIE); FIE recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-369, Full length protein
Sequence
MSKITLGNESIVGSLTPSNKKSYKVTNRIQEGKKPLYAVVFNFLDARFFDVFVTAGGNRITLYNCLGDGAISALQSYADEDKEESFYTVSWACGVNGNPYVAAGGVKGIIRVIDVNSETIHKSLVGHGDSVNEIRTQPLKPQLVITASKDESVRLWNVETGICILIFAGAGGHRYEVLSVDFHPSDIYRFASCGMDTTIKIWSMKEFWTYVEKSFTWTDDPSKFPTKFVQFPVFTASIHTNYVDCNRWFGDFILSKSVDNEILLWEPQLKENSPGEGASDVLLRYPVPMCDIWFIKFSCDLHLSSVAIGNQEGKVYVWDLKSCPPVLITKLSHNQSKSVIRQTAMSVDGSTILACCEDGTIWRWDVITK
Sequence Length
369
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,257 Da
NCBI Official Full Name
Transducin/WD40 repeat-like superfamily protein
NCBI Official Symbol
FIE
NCBI Official Synonym Symbols
FERTILIZATION-INDEPENDENT ENDOSPERM; FERTILIZATION-INDEPENDENT ENDOSPERM 1; FIE1; FIS3
NCBI Protein Information
Transducin/WD40 repeat-like superfamily protein
UniProt Protein Name
Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM
Protein Family
UniProt Gene Name
FIE
UniProt Synonym Gene Names
FIS3

NCBI Description

Encodes a protein similar to the transcriptional regular of the animal Polycomb group and is involved in regulation of establishment of anterior-posterior polar axis in the endosperm and repression of flowering during vegetative phase. Mutation leads endosperm to develop in the absence of fertilization and flowers to form in seedlings and non-reproductive organs. Also exhibits maternal effect gametophytic lethal phenotype, which is suppressed by hypomethylation. Forms part of a large protein complex that can include VRN2 (VERNALIZATION 2), VIN3 (VERNALIZATION INSENSITIVE 3) and polycomb group proteins FERTILIZATION INDEPENDENT ENDOSPERM (FIE), CURLY LEAF (CLF) and SWINGER (SWN or EZA1). The complex has a role in establishing FLC (FLOWERING LOCUS C) repression during vernalization. In the ovule, the FIE transcript levels increase transiently just after fertilization.

Uniprot Description

Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. They probably act via the methylation of histones, rendering chromatin heritably changed in its expressibility. Required to prevent the proliferation of the central cell by repressing unknown target genes before fertilization. Probably also involved in floral repression mechanism established during early plant development. Regulates the anteroposterior organization of the endosperm. Interacts with the promoter and represses the transcription of genes such as PHE1, that are paternally active and maternally silenced.

Research Articles on FIE

Similar Products

Product Notes

The FIE fie (Catalog #AAA1304468) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-369, Full length protein. The amino acid sequence is listed below: MSKITLGNES IVGSLTPSNK KSYKVTNRIQ EGKKPLYAVV FNFLDARFFD VFVTAGGNRI TLYNCLGDGA ISALQSYADE DKEESFYTVS WACGVNGNPY VAAGGVKGII RVIDVNSETI HKSLVGHGDS VNEIRTQPLK PQLVITASKD ESVRLWNVET GICILIFAGA GGHRYEVLSV DFHPSDIYRF ASCGMDTTIK IWSMKEFWTY VEKSFTWTDD PSKFPTKFVQ FPVFTASIHT NYVDCNRWFG DFILSKSVDN EILLWEPQLK ENSPGEGASD VLLRYPVPMC DIWFIKFSCD LHLSSVAIGN QEGKVYVWDL KSCPPVLITK LSHNQSKSVI RQTAMSVDGS TILACCEDGT IWRWDVITK. It is sometimes possible for the material contained within the vial of "Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM (FIE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.