FH1/FH2 domain-containing protein 3 (Fhod3) Recombinant Protein | Fhod3 recombinant protein
Recombinant Mouse FH1/FH2 domain-containing protein 3 (Fhod3) , partial
Gene Names
Fhod3; FHOS2; mKIAA1695; A930009H06Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
FH1/FH2 domain-containing protein 3 (Fhod3); Recombinant Mouse FH1/FH2 domain-containing protein 3 (Fhod3); partial; Fhod3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-405. Partial, provide the GBD/FH3 Domain
Sequence
NSTNFPEPSRPPLFTFREDLALGTQLAGVHRLLRAPHKLDDCTLQLSHNGAYLDLEATLAEQRDELEGFQDDTGRGKKNSIILRTQLSVRVHACIEKLYNSSGRDLRRALFSLKQIFQDDKDLVHEFVIAEGLTCLIKVGAEADQNYQNYILRALGQIMLYVDGMNGVINHSETIQWLYTLVGSKFRLVVKTALKLLLVFVEYSESNAPLLIQAVSAVDTKRGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLAGLPDQDTFYDVVDCLEELGIAAVSQRHLNKKGTDLDLLEQFNIYEVALRHEDGDETAEPPPSGHRDRRRASMCSGGTVGEQQGLDRRRSRRHSIQNIKSPLSAPTSPCSPSVPAFKPSQVRDLCEKDEEEE
Sequence Length
405
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
171,905 Da
NCBI Official Full Name
FH1/FH2 domain-containing protein 3 isoform 2
NCBI Official Synonym Full Names
formin homology 2 domain containing 3
NCBI Official Symbol
Fhod3
NCBI Official Synonym Symbols
FHOS2; mKIAA1695; A930009H06Rik
NCBI Protein Information
FH1/FH2 domain-containing protein 3
UniProt Protein Name
FH1/FH2 domain-containing protein 3
Protein Family
UniProt Gene Name
Fhod3
UniProt Synonym Gene Names
Fhos2; Kiaa1695; mFHOS2
Uniprot Description
May play a role in actin filament polymerization in cardiomyocytes (). Actin-organizing protein that may cause stress fiber formation together with cell elongation.
Research Articles on Fhod3
Similar Products
Product Notes
The Fhod3 fhod3 (Catalog #AAA1446170) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-405. Partial, provide the GBD/FH3 Domain. The amino acid sequence is listed below: NSTNFPEPSR PPLFTFREDL ALGTQLAGVH RLLRAPHKLD DCTLQLSHNG AYLDLEATLA EQRDELEGFQ DDTGRGKKNS IILRTQLSVR VHACIEKLYN SSGRDLRRAL FSLKQIFQDD KDLVHEFVIA EGLTCLIKVG AEADQNYQNY ILRALGQIML YVDGMNGVIN HSETIQWLYT LVGSKFRLVV KTALKLLLVF VEYSESNAPL LIQAVSAVDT KRGVKPWSNI MEILEEKDGV DTELLVYAMT LVNKTLAGLP DQDTFYDVVD CLEELGIAAV SQRHLNKKGT DLDLLEQFNI YEVALRHEDG DETAEPPPSG HRDRRRASMC SGGTVGEQQG LDRRRSRRHS IQNIKSPLSA PTSPCSPSVP AFKPSQVRDL CEKDEEEE . It is sometimes possible for the material contained within the vial of "FH1/FH2 domain-containing protein 3 (Fhod3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
