FGFR1 oncogene partner (FGFR1OP) Recombinant Protein | FGFR1OP recombinant protein
Recombinant Bovine FGFR1 oncogene partner (FGFR1OP)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
FGFR1 oncogene partner (FGFR1OP); Recombinant Bovine FGFR1 oncogene partner (FGFR1OP); FGFR1OP recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-399, full length protein
Sequence
MAATAAAVVAEEDTELRYLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNESLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTFQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKALTSGEGALDLSDVHSPPKSPEGKTGAHTPPSKIPRYKGQGNKKTSGQQPGAKKASNDASHSDTSISSSEPKSRSGLHLLAHETKIGSLLSNNSLDVNAKAGPGPEEDDLEGDSFFDDPIPKPEAAYGWRSEPSKQAGSLASLSDAPPLKSGLSSLAGAPSLKESESKRGNTVLKDLKLVNDKIGSLGLGTGEEDDYVDDFNSTSHRSEKSELSIGEEIEEDLSVEMDDVNTSDKLDDLTQDLTVSQLSDVADYLEDVA
Sequence Length
399
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for FGFR1OP recombinant protein
This gene encodes a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. This gene is thought to play an important role in normal proliferation and differentiation of the erythroid lineage. Alternatively spliced transcript variants that encode different proteins have been identified.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,764 Da
NCBI Official Full Name
FGFR1 oncogene partner
NCBI Official Synonym Full Names
FGFR1 oncogene partner
NCBI Official Symbol
FGFR1OP
NCBI Protein Information
FGFR1 oncogene partner
UniProt Protein Name
FGFR1 oncogene partner
Protein Family
UniProt Gene Name
FGFR1OP
Uniprot Description
Required for anchoring microtubules to the centrosomes. Required for ciliation.
Similar Products
Product Notes
The FGFR1OP fgfr1op (Catalog #AAA1381873) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-399, full length protein. The amino acid sequence is listed below: MAATAAAVVA EEDTELRYLL VQTLENSGVL NRIKAELRAA VFLALEEQEK VENKTPLVNE SLKKFLNTKD GRLVASLVAE FLQFFNLDFT LAVFQPETST FQGLEGRENL ARDLGIIEAE GTVGGPLLLE VIRRCQQKEK ALTSGEGALD LSDVHSPPKS PEGKTGAHTP PSKIPRYKGQ GNKKTSGQQP GAKKASNDAS HSDTSISSSE PKSRSGLHLL AHETKIGSLL SNNSLDVNAK AGPGPEEDDL EGDSFFDDPI PKPEAAYGWR SEPSKQAGSL ASLSDAPPLK SGLSSLAGAP SLKESESKRG NTVLKDLKLV NDKIGSLGLG TGEEDDYVDD FNSTSHRSEK SELSIGEEIE EDLSVEMDDV NTSDKLDDLT QDLTVSQLSD VADYLEDVA. It is sometimes possible for the material contained within the vial of "FGFR1 oncogene partner (FGFR1OP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
