Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Free fatty acid receptor 2 (Ffar2) Recombinant Protein | Ffar2 recombinant protein

Recombinant Mouse Free fatty acid receptor 2 (Ffar2)

Gene Names
Ffar2; Gpr43; GPCR43
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Free fatty acid receptor 2 (Ffar2); Recombinant Mouse Free fatty acid receptor 2 (Ffar2); Ffar2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-330aa; full length protein
Sequence
MTPDWHSSLILTAYILIFLTGLPANLLALRAFMGRVRQPQPAPVHILLLNLTLADLLLLL LLPFRIVEAASNFRWYLPKIVCALTGFGFYSSIYCSTWLLAGISMERYLGVAFPVQYKLS RRPLYGVIAALVAWIMSFGHCTIVIIVQYLNSTEQVGTENQITCYENFTQEQLDVVLPVR LELCLVLFFVPMAVTIFCYWRFVWIMLTQPHVGAQRRRRAVGLAVVTLLNFLVCFGPYNM SHLVGFYLRQSPSWRVEAVVFSSLNASLDPLLFYFSSSVVRRAFGKGLLLIRNPASSMLG RGAKETVEGTKMDRGGSQAEGVQSSEFVTE
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ffar2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,124 Da
NCBI Official Full Name
free fatty acid receptor 2
NCBI Official Synonym Full Names
free fatty acid receptor 2
NCBI Official Symbol
Ffar2
NCBI Official Synonym Symbols
Gpr43; GPCR43
NCBI Protein Information
free fatty acid receptor 2
UniProt Protein Name
Free fatty acid receptor 2
Protein Family
UniProt Gene Name
Ffar2
UniProt Synonym Gene Names
Gpr43; Lssig
UniProt Entry Name
FFAR2_MOUSE

Uniprot Description

FFAR2: Receptor for short chain fatty acids through a G(i)- protein-mediated inhibition of adenylyl cyclase and elevation of intracellular calcium. The rank order of potency for agonists of this receptor is acetate= propionate = butyrate > pentanoate = formate. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR

Cellular Component: cell projection; integral to membrane; membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; lipid binding; signal transducer activity

Biological Process: cell surface pattern recognition receptor signaling pathway; fat cell differentiation; G-protein coupled receptor protein signaling pathway; glucose homeostasis; immune system process; inflammatory response; leukocyte chemotaxis during inflammatory response; mucosal immune response; positive regulation of acute inflammatory response to non-antigenic stimulus; positive regulation of chemokine production; positive regulation of cytokine production during immune response; regulation of acute inflammatory response; sequestering of lipid; signal transduction

Research Articles on Ffar2

Similar Products

Product Notes

The Ffar2 ffar2 (Catalog #AAA7014731) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-330aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ffar2 ffar2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTPDWHSSLI LTAYILIFLT GLPANLLALR AFMGRVRQPQ PAPVHILLLN LTLADLLLLL LLPFRIVEAA SNFRWYLPKI VCALTGFGFY SSIYCSTWLL AGISMERYLG VAFPVQYKLS RRPLYGVIAA LVAWIMSFGH CTIVIIVQYL NSTEQVGTEN QITCYENFTQ EQLDVVLPVR LELCLVLFFV PMAVTIFCYW RFVWIMLTQP HVGAQRRRRA VGLAVVTLLN FLVCFGPYNM SHLVGFYLRQ SPSWRVEAVV FSSLNASLDP LLFYFSSSVV RRAFGKGLLL IRNPASSMLG RGAKETVEGT KMDRGGSQAE GVQSSEFVTE. It is sometimes possible for the material contained within the vial of "Free fatty acid receptor 2 (Ffar2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.