Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Squalene synthase (Fdft1) Recombinant Protein | Fdft1 recombinant protein

Recombinant Mouse Squalene synthase (Fdft1)

Gene Names
Fdft1; SS; SQS
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Squalene synthase (Fdft1); Recombinant Mouse Squalene synthase (Fdft1); Recombinant Squalene synthase (Fdft1); Squalene synthase; SQS; SS EC= 2.5.1.21; FPP:FPP farnesyltransferase Farnesyl-diphosphate farnesyltransferase; Fdft1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-416
Sequence
MEFVKCLGHPEEFYNLLRFRMGGRRNFIPKMDQDSLSSSLKTCYKYLNQTSRSFAAVIQALDGDIRHAICVFYLVLRALDTVEDDMSISVEKKIPLLCNFHTFLYDPEWRFTESKEKDRQVLEDFPTISLEFRNLAEKYQTVIDDICHRMGCGMAEFVDKDVTSKQDWDKYCHYVAGLVGIGLSRLFSASEFEDPIVGEDIECANSMGLFLQKTNIIRDYLEDQQEGRKFWPQEVWGRYIKKLEDFAKPENVDVAVQCLNELITNTLQHIPDVLTYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGVVKIRKGQAVTLMMDATNMPAVKAIIYQYIEEIYHRIPNSDPSSSKTKQVISKIRTQNLPNCQLISRSHYSPIYLSFIMLLAALSWQYLSTLSQVTEDYVQREH
Sequence Length
416
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,154 Da
NCBI Official Full Name
squalene synthase
NCBI Official Synonym Full Names
farnesyl diphosphate farnesyl transferase 1
NCBI Official Symbol
Fdft1
NCBI Official Synonym Symbols
SS; SQS
NCBI Protein Information
squalene synthase; squalene synthetase; FPP:FPP farnesyltransferase; farnesyl-diphosphate farnesyltransferase
UniProt Protein Name
Squalene synthase
UniProt Gene Name
Fdft1
UniProt Synonym Gene Names
Erg9; SQS; SS
UniProt Entry Name
FDFT_MOUSE

Uniprot Description

FDFT1: a membrane-associated enzyme located at a branch point in the mevalonate pathway. The encoded protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene. [provided by RefSeq, Jul 2008]

Protein type: Endoplasmic reticulum; Transferase; Membrane protein, multi-pass; Membrane protein, integral; EC 2.5.1.21; Lipid Metabolism - steroid biosynthesis; Oxidoreductase

Cellular Component: intracellular membrane-bound organelle; membrane; endoplasmic reticulum; integral to membrane

Molecular Function: farnesyl-diphosphate farnesyltransferase activity; transferase activity, transferring alkyl or aryl (other than methyl) groups; transferase activity; oxidoreductase activity; catalytic activity

Biological Process: steroid metabolic process; cholesterol metabolic process; isoprenoid biosynthetic process; metabolic process; sterol biosynthetic process; lipid biosynthetic process; biosynthetic process; lipid metabolic process; farnesyl diphosphate metabolic process; cholesterol biosynthetic process; steroid biosynthetic process

Research Articles on Fdft1

Similar Products

Product Notes

The Fdft1 fdft1 (Catalog #AAA955541) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-416. The amino acid sequence is listed below: MEFVKCLGHP EEFYNLLRFR MGGRRNFIPK MDQDSLSSSL KTCYKYLNQT SRSFAAVIQA LDGDIRHAIC VFYLVLRALD TVEDDMSISV EKKIPLLCNF HTFLYDPEWR FTESKEKDRQ VLEDFPTISL EFRNLAEKYQ TVIDDICHRM GCGMAEFVDK DVTSKQDWDK YCHYVAGLVG IGLSRLFSAS EFEDPIVGED IECANSMGLF LQKTNIIRDY LEDQQEGRKF WPQEVWGRYI KKLEDFAKPE NVDVAVQCLN ELITNTLQHI PDVLTYLSRL RNQSVFNFCA IPQVMAIATL AACYNNQQVF KGVVKIRKGQ AVTLMMDATN MPAVKAIIYQ YIEEIYHRIP NSDPSSSKTK QVISKIRTQN LPNCQLISRS HYSPIYLSFI MLLAALSWQY LSTLSQVTED YVQREH. It is sometimes possible for the material contained within the vial of "Squalene synthase (Fdft1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.