Ficolin-3 (FCN3) Recombinant Protein | FCN3 recombinant protein

Recombinant Human Ficolin-3 (FCN3)

Cat. Num. AAA1167484

• Gene Names: FCN3; FCNH; HAKA1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ficolin-3 (FCN3); Recombinant Human Ficolin-3 (FCN3); FCN3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-299, Full length protein
• Sequence: QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
• Sequence Length: 276

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for FCN3 recombinant protein

Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity. This protein is a thermolabile beta-2-macroglycoprotein found in all human serum and is a member of the ficolin
opsonin p35 lectin family. The protein, which was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus, has been shown to have a calcium-independent lectin activity. The protein can activate the complement pathway in association with MASPs and sMAP, thereby aiding in host defense through the activation of the lectin pathway. Alternative splicing occurs at this locus and two variants, each encoding a distinct isoform, have been identified.

NCBI and Uniprot Product Information

• NCBI GI #: 27754776
• NCBI GeneID: 8547
• NCBI Accession #: NP_003656.2
• NCBI GenBank Nucleotide #: NM_003665.3
• UniProt Accession #: O75636; Q6IBJ5; Q8WW86
• Molecular Weight: 31,678 Da
• NCBI Official Full Name: ficolin-3 isoform 1
• NCBI Official Synonym Full Names: ficolin 3
• NCBI Official Symbol: FCN3
• NCBI Official Synonym Symbols: FCNH; HAKA1
• NCBI Protein Information: ficolin-3
• UniProt Protein Name: Ficolin-3
• Protein Family: Ficolin
• UniProt Gene Name: FCN3
• UniProt Synonym Gene Names: FCNH; HAKA1

NCBI Description

Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity. The protein encoded by this gene is a thermolabile beta-2-macroglycoprotein found in all human serum and is a member of the ficolin/opsonin p35 lectin family. The protein, which was initially identified based on its reactivity with sera from patients with systemic lupus erythematosus, has been shown to have a calcium-independent lectin activity. The protein can activate the complement pathway in association with MASPs and sMAP, thereby aiding in host defense through the activation of the lectin pathway. Alternative splicing occurs at this locus and two variants, each encoding a distinct isoform, have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Has affinity with GalNAc, GlcNAc, D-fucose, as mono/oligosaccharide and lipopolysaccharides from S.typhimurium and S.minnesota.