SDS-PAGE
Fas apoptotic inhibitory molecule 3 Recombinant Protein | Faim3 recombinant protein
Recombinant Mouse Fas apoptotic inhibitory molecule 3
Gene Names
Fcmr; Toso; Faim3; FcmuR; 1810037B05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Fas apoptotic inhibitory molecule 3; Recombinant Mouse Fas apoptotic inhibitory molecule 3; Regulator of Fas-induced apoptosis Toso; Faim3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-262aa; Extracellular Domain
Sequence
RVLPEVQLNVEWGGSIIIECPLPQLHVRMYLCRQMAKPGICSTVVSNTFVKKEYERRVTLTPCLDKKLFLVEMTQLTENDDGIYACGVGMKTDKGKTQKITLNVHNEYPEPFWEDEWTSERPRWLHRFLQHQMPWLHGSEHPSSSGVIAKVTTPAPKTEAPPVHQPSSITSVTQHPRVYRAFSVSATKSPALLPATTASKTSTQQAIRPLEASYSHHTRLHEQRTRHHGPHYGREDRGLHIPIPE
Sequence Length
422
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Faim3 recombinant protein
May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Ses to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation.
References
Song Y., Jacob C.O.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43.9 kDa
NCBI Official Full Name
fas apoptotic inhibitory molecule 3
NCBI Official Synonym Full Names
Fc fragment of IgM receptor
NCBI Official Symbol
Fcmr
NCBI Official Synonym Symbols
Toso; Faim3; FcmuR; 1810037B05Rik
NCBI Protein Information
fas apoptotic inhibitory molecule 3
UniProt Protein Name
Fas apoptotic inhibitory molecule 3
Protein Family
UniProt Gene Name
Fcmr
UniProt Entry Name
FAIM3_MOUSE
Uniprot Description
FAIM3: May play a role in the immune system processes. Protects cells from FAS-, TNF alpha- and FADD-induced apoptosis without increasing expression of the inhibitors of apoptosis BCL2 and BCLXL. Seems to activate an inhibitory pathway that prevents CASP8 activation following FAS stimulation, rather than blocking apoptotic signals downstream. May inhibit FAS-induced apoptosis by preventing CASP8 processing through CFLAR up-regulation. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Apoptosis
Cellular Component: cell surface; external side of plasma membrane; integral to membrane; membrane
Molecular Function: protein binding
Biological Process: immune system process
Research Articles on Faim3
Similar Products
Product Notes
The Faim3 fcmr (Catalog #AAA951872) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-262aa; Extracellular Domain. The amino acid sequence is listed below: RVLPEVQLNV EWGGSIIIEC PLPQLHVRMY LCRQMAKPGI CSTVVSNTFV KKEYERRVTL TPCLDKKLFL VEMTQLTEND DGIYACGVGM KTDKGKTQKI TLNVHNEYPE PFWEDEWTSE RPRWLHRFLQ HQMPWLHGSE HPSSSGVIAK VTTPAPKTEA PPVHQPSSIT SVTQHPRVYR AFSVSATKSP ALLPATTASK TSTQQAIRPL EASYSHHTRL HEQRTRHHGP HYGREDRGLH IPIPE. It is sometimes possible for the material contained within the vial of "Fas apoptotic inhibitory molecule 3, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
