Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data

CD89 recombinant protein

CD89 Recombinant Protein

Gene Names
FCAR; CD89; FcalphaRI; CTB-61M7.2
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Synonyms
CD89; CD89 Recombinant Protein; CD89 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Sequence
QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN
Restriction Site
NdeI-XhoI
Expression Vector
pet-22b(+)
Preparation and Storage
Store at 4 degree C short term. Aliquot and store at -20 degree C long term. Avoid freeze-thaw cycles.

Testing Data

Testing Data
Related Product Information for CD89 recombinant protein
Fc (Ig constant fragment) receptors ensure protection of the host against foreign antigens, such as microorganisms and pathogens, by removing Ig-coated antigen complexes from circulation. Fc receptors are present on lymphoid and myeloid derivatives, where they mediate endocytosis of Ig-antigen complexes, antibody production in B cells through T cell antigen presentation, cytotoxicity and the release of cytokines and reactive oxygen species. CD89, also known as Immunoglobulin alpha Fc receptor (Fc alpha RI), is a glycoprotein that is expressed on the surface of neutrophils, monocytes, macrophages and eosinophils and is a potent cytotoxic trigger molecule. CD89 specifically interacts with aggregated IgAs, not IgG. Cytokines can initiate a high-binding state for CD89 through a mechanism that involves the intracellular C-terminus of CD89. Polymorphisms within the gene encoding CD89 may be associated with susceptibility to IgA nephropathy, a form of glomerulonephritis characterized by IgA antibody deposition in the kidney glomerulus.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
28,343 Da
NCBI Official Full Name
Immunoglobulin alpha Fc receptor
NCBI Official Synonym Full Names
Fc fragment of IgA receptor
NCBI Official Symbol
FCAR
NCBI Official Synonym Symbols
CD89; FcalphaRI; CTB-61M7.2
NCBI Protein Information
immunoglobulin alpha Fc receptor
UniProt Protein Name
Immunoglobulin alpha Fc receptor
UniProt Gene Name
FCAR
UniProt Synonym Gene Names
CD89; IgA Fc receptor

NCBI Description

This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Binds to the Fc region of immunoglobulins alpha. Mediates several functions including cytokine production.

Research Articles on CD89

Similar Products

Product Notes

The CD89 fcar (Catalog #AAA3016015) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QEGDFPMPFI SAKSSPVIPL DGSVKIQCQA IREAYLTQLM IIKNSTYREI GRRLKFWNET DPEFVIDHMD ANKAGRYQCQ YRIGHYRFRY SDTLELVVTG LYGKPFLSAD RGLVLMPGEN ISLTCSSAHI PFDRFSLAKE GELSLPQHQS GEHPANFSLG PVDLNVSGIY RCYGWYNRSP YLWSFPSNAL ELVVTDSIHQ DYTTQN. It is sometimes possible for the material contained within the vial of "CD89, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.