F-box/WD repeat-containing protein 7 (Fbxw7) Recombinant Protein | Fbxw7 recombinant protein

Recombinant Mouse F-box/WD repeat-containing protein 7 (Fbxw7)

Cat. Num. AAA1430571

• Gene Names: Fbxw7; AGO; Cdc4; Fbw7; Fbwd6; Fbx30; Fbxw6; Fbxo30; SEL-10; 1110001A17Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: F-box/WD repeat-containing protein 7 (Fbxw7); Recombinant Mouse F-box/WD repeat-containing protein 7 (Fbxw7); Fbxw7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-629. Full Length of Isoform 2
• Sequence: MRVCVPSSVLVLSCVCWCWGVLLPVPLPNLPFLACLSMSTLESVTYLPEKGLYCQRLPSSRTHGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSDYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Fbxw7 recombinant protein

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. This protein was previously referred to as FBX30, and belongs to the Fbws class; in addition to an F-box, this protein contains 7 tandem WD40 repeats. This protein binds directly to cyclin E and probably targets cyclin E for ubiquitin-mediated degradation. Mutations in this gene are detected in ovarian and breast cancer cell lines, implicating the gene s potential role in the pathogenesis of human cancers. Three transcript variants encoding three different isoforms have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 21218434
• NCBI GeneID: 50754
• NCBI Accession #: NP_536353.2
• NCBI GenBank Nucleotide #: NM_080428.3
• UniProt Accession #: Q8VBV4; Q8CCS5; Q8VHP4; A2RRI5
• Molecular Weight: 70,547 Da
• NCBI Official Full Name: F-box/WD repeat-containing protein 7 isoform 2
• NCBI Official Synonym Full Names: F-box and WD-40 domain protein 7
• NCBI Official Symbol: Fbxw7
• NCBI Official Synonym Symbols: AGO; Cdc4; Fbw7; Fbwd6; Fbx30; Fbxw6; Fbxo30; SEL-10; 1110001A17Rik
• NCBI Protein Information: F-box/WD repeat-containing protein 7
• UniProt Protein Name: F-box/WD repeat-containing protein 7
• Protein Family: F-box/WD repeat-containing protein
• UniProt Gene Name: Fbxw7

Uniprot Description

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:21953459). Recognizes and binds phosphorylated sites/phosphodegrons within target proteins and thereafter bring them to the SCF complex for ubiquitination (). Identified substrates include cyclin-E (CCNE1 or CCNE2), JUN, MYC, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1 (). Acts as a negative regulator of JNK signaling by binding to phosphorylated JUN and promoting its ubiquitination and subsequent degradation (). SCF(FBXW7) complex mediates the ubiquitination and subsequent degradation of NFE2L1 (PubMed:21953459).