Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

F-box only protein 32 (Fbxo32) Recombinant Protein | Fbxo32 recombinant protein

Recombinant Rat F-box only protein 32 (Fbxo32)

Gene Names
Fbxo32; MAFbx; Atrogin1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
F-box only protein 32 (Fbxo32); Recombinant Rat F-box only protein 32 (Fbxo32); Fbxo32 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-350, full length protein
Sequence
MPFLGQDWRSPGQSWVKTADGWKRFLDEKSGTFVSDLSSYCNKENLFNSLNYDVAAKKRKKDIQNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETTLHWQQQLNSIQISRPAFKGLTITDLPVCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKRLCQYHFSERQIRKRLILSDKGQLDWKKMYFKLVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
Sequence Length
350
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Fbxo32 recombinant protein
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. This protein belongs to the Fbxs class and contains an F-box domain. This protein is highly expressed during muscle atrophy, whereas mice deficient in this gene were found to be resistant to atrophy. This protein is thus a potential drug target for the treatment of muscle atrophy. Alternative splicing of this gene results in two transcript variants encoding two isoforms of different sizes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,926 Da
NCBI Official Full Name
F-box only protein 32
NCBI Official Synonym Full Names
F-box protein 32
NCBI Official Symbol
Fbxo32
NCBI Official Synonym Symbols
MAFbx; Atrogin1
NCBI Protein Information
F-box only protein 32
UniProt Protein Name
F-box only protein 32
Protein Family
UniProt Gene Name
Fbxo32
UniProt Synonym Gene Names
MAFbx

NCBI Description

may act as an SCF-type E3 ubiquitin ligase; plays a role in skeletal atrophy [RGD, Feb 2006]

Uniprot Description

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins during skeletal muscle atrophy. Recognizes TERF1 ().

Research Articles on Fbxo32

Similar Products

Product Notes

The Fbxo32 fbxo32 (Catalog #AAA1423624) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-350, full length protein. The amino acid sequence is listed below: MPFLGQDWRS PGQSWVKTAD GWKRFLDEKS GTFVSDLSSY CNKENLFNSL NYDVAAKKRK KDIQNSKTKT QYFHQEKWIY VHKGSTKERH GYCTLGEAFN RLDFSTAILD SRRFNYVVRL LELIAKSQLT SLSGIAQKNF MNILEKVVLK VLEDQQNIRL IRELLQTLYT SLCTLVQRVG KSVLVGNINM WVYRMETTLH WQQQLNSIQI SRPAFKGLTI TDLPVCLQLN IMQRLSDGRD LVSLGQAAPD LHVLSEDRLL WKRLCQYHFS ERQIRKRLIL SDKGQLDWKK MYFKLVRCYP RREQYGVTLQ LCKHCHILSW KGTDHPCTAN NPESCSVSLS PQDFINLFKF. It is sometimes possible for the material contained within the vial of "F-box only protein 32 (Fbxo32), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.