F-box/LRR-repeat protein 7 (FBXL7) Recombinant Protein | FBXL7 recombinant protein

Recombinant Human F-box/LRR-repeat protein 7 (FBXL7)

Cat. Num. AAA1389463

• Gene Names: FBXL7; FBL6; FBL7
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: F-box/LRR-repeat protein 7 (FBXL7); Recombinant Human F-box/LRR-repeat protein 7 (FBXL7); FBXL7 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-491, Full length protein
• Sequence: MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALICPPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPAFF
• Sequence Length: 491

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for FBXL7 recombinant protein

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. This protein belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats.

NCBI and Uniprot Product Information

• NCBI GI #: 508083038
• NCBI GeneID: 23194
• NCBI Accession #: NP_001265246.1
• NCBI GenBank Nucleotide #: NM_001278317.1
• UniProt Accession #: Q9UJT9; O94926; B9EGF1; D6RDY7
• Molecular Weight: 49,844 Da
• NCBI Official Full Name: F-box/LRR-repeat protein 7 isoform 2
• NCBI Official Synonym Full Names: F-box and leucine rich repeat protein 7
• NCBI Official Symbol: FBXL7
• NCBI Official Synonym Symbols: FBL6; FBL7
• NCBI Protein Information: F-box/LRR-repeat protein 7
• UniProt Protein Name: F-box/LRR-repeat protein 7
• Protein Family: F-box/LRR-repeat protein
• UniProt Gene Name: FBXL7
• UniProt Synonym Gene Names: FBL6; FBL7; KIAA0840

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by a 42-48 amino acid motif, the F-box, which binds to the S-phase kinase-associated protein 1 (Skp1) protein. The F-box proteins constitute one of the four subunits of E3 ubiquitin protein ligases called SCFs (SKP1-Cul1-F-box), which play a role in phosphorylation-dependent ubiquitination of proteins. The F-box proteins are divided into 3 subfamilies based on the other domain in the protein: F-box proteins that also have a WD-40 domain (Fbws subfamily), F-box proteins that also have leucine-rich repeats (Fbls subfamily) and F-box proteins that contain other motifs or lack known protein-interaction domains (Fbxs subfamily). The protein encoded by this gene belongs to the Fbls subfamily. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]

Uniprot Description

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of AURKA during mitosis, causing mitotic arrest.