Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Redox-regulatory protein FAM213A (fam213a) Recombinant Protein | fam213a recombinant protein

Recombinant Danio rerio Redox-regulatory protein FAM213A (fam213a)

Gene Names
selenou1a; selu; sepu; fam213a; fc08d10; selenou; fam213aa; zgc:73311; wu:fb06a02; wu:fc08d10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Redox-regulatory protein FAM213A (fam213a); Recombinant Danio rerio Redox-regulatory protein FAM213A (fam213a); fam213a recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-212, Full length protein
Sequence
MGMWSLGLGAVGAAIAGLILANTDFLLTKSAPATVDYLANADLKTIDGDERSLKAKALWEKSGAVIMAVRRPGUFLCREEASELSSLKPQLDELGVPLYAVVKENVGTEIQDFRPHFAGEIFLDEKQAFYGPQQRKMGGLGFIRLGVWQNFVRAWRAGYQGNMNGEGFILGGVFVMGSGGQGVLLEHREKEFGDKVSLESVLEAAKKVVVEK
Sequence Length
212
Species
Zebrafish
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,043 Da
NCBI Official Full Name
selenoprotein U 1a
NCBI Official Synonym Full Names
selenoprotein U 1a
NCBI Official Symbol
selenou1a
NCBI Official Synonym Symbols
selu; sepu; fam213a; fc08d10; selenou; fam213aa; zgc:73311; wu:fb06a02; wu:fc08d10
NCBI Protein Information
selenoprotein U 1a
UniProt Protein Name
Redox-regulatory protein FAM213A
Protein Family
UniProt Gene Name
fam213a
UniProt Synonym Gene Names
pamm; Protein PAMM

NCBI Description

The protein encoded by this gene belongs to a subfamily of FAM213A/selenoprotein U (SelU), within a peroxiredoxin-like FAM213 superfamily. SelU is unusual in that it has restricted phylogenetic distribution in vertebrates, such as in chicken and fish. Other vertebrate members of this family, including mammals, contain cysteine-containing homologues. SelU proteins contain UxxC (U for selenocysteine and C for cysteine) motif in place of the catalytic CxxC motif found in cysteine-containing homologues. The latter function as redox regulatory proteins, suggesting a similar role for SelU proteins. Like majority of selenoproteins, SelU contains a single selenocysteine (Sec) residue encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs in vertebrates contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. A paralog of this gene exists on chromosome 12 (GeneID:767744). [provided by RefSeq, Aug 2017]

Uniprot Description

Involved in redox regulation of the cell. Acts as an antioxidant ().

Similar Products

Product Notes

The fam213a fam213a (Catalog #AAA1402659) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-212, Full length protein. The amino acid sequence is listed below: MGMWSLGLGA VGAAIAGLIL ANTDFLLTKS APATVDYLAN ADLKTIDGDE RSLKAKALWE KSGAVIMAVR RPGUFLCREE ASELSSLKPQ LDELGVPLYA VVKENVGTEI QDFRPHFAGE IFLDEKQAFY GPQQRKMGGL GFIRLGVWQN FVRAWRAGYQ GNMNGEGFIL GGVFVMGSGG QGVLLEHREK EFGDKVSLES VLEAAKKVVV EK. It is sometimes possible for the material contained within the vial of "Redox-regulatory protein FAM213A (fam213a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.