Extracellular serine/threonine kinase FAM20C (FAM20C) Recombinant Protein | FAM20C recombinant protein
Recombinant Human Extracellular serine/threonine protein kinase FAM20C (FAM20C), partial
Gene Names
FAM20C; RNS; DMP4; DMP-4; GEF-CK
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Extracellular serine/threonine kinase FAM20C (FAM20C); Recombinant Human Extracellular serine/threonine protein kinase FAM20C (FAM20C); partial; Dentin matrix protein 4; FAM20C recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyop
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyop
Sequence Positions
354-565aa, Partial
Sequence
FISPANNICFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQTPPYDSSHRILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVRDCVERNG
Species
HU-Human
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Function
Golgi serine/threonine protein kinase that phosphorylates secretory pathway proteins within Ser-x-Glu/pSer motifs and plays a key role in biomineralization of bones and teeth (PubMed:22582013, PubMed:23754375, PubMed:25789606). Constitutes the main protein kinase for extracellular proteins, generating the majority of the extracellular phosphoproteome (PubMed:26091039). Mainly phosphorylates proteins within the Ser-x-Glu/pSer motif, but also displays a broader substrate specificity (PubMed:26091039). Phosphorylates casein as well as a number of proteins involved in biomineralization such as AMELX, AMTN, ENAM and SPP1 (PubMed:22582013, PubMed:25789606). In addition to its role in biomineralization, also plays a role in lipid homeostasis, wound healing and cell migration and adhesion (PubMed:26091039).
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Product Categories/Family for FAM20C recombinant protein
References
"FAM20: an evolutionarily conserved family of secreted proteins expressed in hematopoietic cells."Nalbant D., Youn H., Nalbant S.I., Sharma S., Cobos E., Beale E.G., Du Y., Williams S.C.BMC Genomics 6:11-11 (2005)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,597 Da
NCBI Official Full Name
extracellular serine/threonine protein kinase FAM20C
NCBI Official Synonym Full Names
family with sequence similarity 20, member C
NCBI Official Symbol
FAM20C
NCBI Official Synonym Symbols
RNS; DMP4; DMP-4; GEF-CK
NCBI Protein Information
extracellular serine/threonine protein kinase FAM20C; dentin matrix protein 4; golgi-enriched fraction casein kinase
UniProt Protein Name
Extracellular serine/threonine protein kinase FAM20C
Protein Family
UniProt Gene Name
FAM20C
UniProt Synonym Gene Names
DMP4; DMP-4; GEF-CK
UniProt Entry Name
DMP4_HUMAN
Similar Products
Product Notes
The FAM20C fam20c (Catalog #AAA7137031) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 354-565aa, Partial. The amino acid sequence is listed below: FISPANNICF YGECSYYCST EHALCGKPDQ IEGSLAAFLP DLSLAKRKTW RNPWRRSYHK RKKAEWEVDP DYCEEVKQTP PYDSSHRILD VMDMTIFDFL MGNMDRHHYE TFEKFGNETF IIHLDNGRGF GKYSHDELSI LVPLQQCCRI RKSTYLRLQL LAKEEYKLSL LMAESLRGDQ VAPVLYQPHL EALDRRLRVV LKAVRDCVER NG. It is sometimes possible for the material contained within the vial of "Extracellular serine/threonine kinase FAM20C (FAM20C), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
