Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Fatty Acid Binding Protein 5, Epidermal Recombinant Protein | FABP5 recombinant protein

Fatty Acid Binding Protein 5, Epidermal, Recombinant, Human (EFABP, FABP5, mal1, MGC133132)

Gene Names
FABP5; EFABP; KFABP; E-FABP; PAFABP; PA-FABP
Applications
ELISA, Western Blot
Purity
Affinity Purified
>90% (SDS-PAGE). Two-step procedure using size exclusion chromatography before and after refolding.
Synonyms
Fatty Acid Binding Protein 5; Epidermal; Recombinant; Human (EFABP; FABP5; mal1; MGC133132); FABP5 recombinant protein
Ordering
For Research Use Only!
Specificity
The amino acid sequence of the recombinant human EFABP is 100% homologous to the amino acid sequence of the human EFABP.
Purity/Purification
Affinity Purified
>90% (SDS-PAGE). Two-step procedure using size exclusion chromatography before and after refolding.
Form/Format
Supplied as a lyophilized powder from PBS. Reconstitute with 0.2ml of sterile ddH20 and let the lyophilized pellet dissolve completely.
Sequence
MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCRIYEKVE
Applicable Applications for FABP5 recombinant protein
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in Western Blot and ELISA., Optimal dilutions to be determined by researcher
Protein Content
0.1mg (BCA)
Preparation and Storage
Store lyophilized protein at -20 degree C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 degree C for a limited period of time; it does not show any change after two weeks at 4 degree C. The lyophilized protein remains stable at least 12 months when stored at -20 degree C.
Related Product Information for FABP5 recombinant protein
Adipocyte fatty acid binding protein FABP5 is a 15kD member of the intracellular fatty acid binding protein (FABP) family, which is known for the ability to bind fatty acids and related compounds (bile acids or retinoids). in an internal cavity. The fatty acid binding proteins aP2 (fatty acid binding protein [FABP]-4) and mal1 (FABP5) are closely related and both are expressed in adipocytes. Absence of FABP5/mal1 resulted in increased systemic insulin sensitivity in two models of obesity and insulin resistance. Adipocytes isolated from mal1-deficient mice also exhibited enhanced insulin-stimulated glucose transport capacity. In contrast, mice expressing high levels of mal1 in adipose tissue display reduced systemic insulin sensitivity.
Product Categories/Family for FABP5 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15.2kD
NCBI Official Full Name
fatty acid-binding protein, epidermal
NCBI Official Synonym Full Names
fatty acid binding protein 5 (psoriasis-associated)
NCBI Official Symbol
FABP5
NCBI Official Synonym Symbols
EFABP; KFABP; E-FABP; PAFABP; PA-FABP
NCBI Protein Information
fatty acid-binding protein, epidermal; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog
UniProt Protein Name
Fatty acid-binding protein, epidermal
UniProt Gene Name
FABP5
UniProt Synonym Gene Names
E-FABP; PA-FABP
UniProt Entry Name
FABP5_HUMAN

NCBI Description

This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]

Uniprot Description

FABP5: High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 8q21.13

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function: protein binding; transporter activity; fatty acid binding; lipid binding

Biological Process: epidermis development; phosphatidylcholine biosynthetic process; glucose metabolic process; glucose transport; lipid metabolic process

Research Articles on FABP5

Similar Products

Product Notes

The FABP5 fabp5 (Catalog #AAA635782) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Fatty Acid Binding Protein 5, Epidermal can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in Western Blot and ELISA., Optimal dilutions to be determined by researcher. Researchers should empirically determine the suitability of the FABP5 fabp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MATVQQLEGR WRLVDSKGFD EYMKELGVGI ALRKMGAMAK PDCIITCDGK NLTIKTESTL KTTQFSCTLG EKFEETTADG RKTQTVCNFT DGALVQHQEW DGKESTITRK LKDGKLVVEC VMNNVTCRIY EKVE. It is sometimes possible for the material contained within the vial of "Fatty Acid Binding Protein 5, Epidermal, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.