CD142 recombinant protein

CD142 Recombinant Protein

Cat. Num. AAA3003973

• Gene Names: F3; TF; TFA; CD142
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD142; CD142 Recombinant Protein; CD142 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 669
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD142 recombinant protein

Background: Tissue Factor (TF)/CD142 (Coagulation factor III/Thromboplastin) is a type-I transmembrane glycoprotein that serves as the cell surface receptor and cofactor for blood coagulation factors VII and VIIa, and thus plays a central role in hemostasis and thrombosis. The TF:VIIa receptor-ligand complex is widely recognized as the initiator of the extrinsic blood coagulation protease cascade, which ultimately leads to the generation of fibrin and thrombin. A member of the type-II cytokine receptor superfamily, TF has also been shown to engage the PI3K and MAPK signaling cascades upon binding to factor VIIa in order to drive cellular responses such as cell migration, growth, and proliferation. Although the function of TF under physiologic conditions is to coordinate blood clotting in response to tissue damage, TF is implicated in pathologic conditions such as tumorigenesis. Indeed, TF is aberrantly expressed in colorectal cancer, breast cancer, pancreatic cancer, and glioblastoma multiforme. It has been shown to promote tumor angiogenesis, tumor growth, metastasis, and venous thrombosis. Given that TF overexpression is associated with numerous types of solid tumors, it has garnered much attention as a potential therapeutic target.

NCBI and Uniprot Product Information

• NCBI GI #: 296010912
• NCBI GeneID: 2152
• NCBI Accession #: NP_001171567.1
• NCBI GenBank Nucleotide #: NM_001178096.1
• UniProt Accession #: P13726; Q6FHG2; Q86WH4; D3DT47
• Molecular Weight: 33,068 Da
• NCBI Official Full Name: tissue factor isoform 2
• NCBI Official Synonym Full Names: coagulation factor III (thromboplastin, tissue factor)
• NCBI Official Symbol: F3
• NCBI Official Synonym Symbols: TF; TFA; CD142
• NCBI Protein Information: tissue factor
• UniProt Protein Name: Tissue factor
• UniProt Gene Name: F3
• UniProt Synonym Gene Names: TF
• UniProt Entry Name: TF_HUMAN

NCBI Description

This gene encodes coagulation factor III which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces. There are 3 distinct domains of this factor: extracellular, transmembrane, and cytoplasmic. This protein is the only one in the coagulation pathway for which a congenital deficiency has not been described. Alternate splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

F3: Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited protolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade. Interacts with HSPE; the interaction, inhibited by heparin, promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII. TF expression is highly dependent upon cell type. TF can also be induced by the inflammatory mediators interleukin 1 and TNF-alpha, as well as by endotoxin, to appear on monocytes and vascular endothelial cells as a component of cellular immune response. Lung, placenta and pancreas. Belongs to the tissue factor family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p22-p21

Cellular Component: extracellular matrix; extracellular space; cell surface; integral to membrane; plasma membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; protein binding; protease binding; phospholipid binding

Biological Process: caspase activation; activation of blood coagulation via clotting cascade; positive regulation of protein kinase B signaling cascade; blood coagulation, extrinsic pathway; positive regulation of angiogenesis; activation of plasma proteins during acute inflammatory response; positive regulation of positive chemotaxis; cytokine and chemokine mediated signaling pathway; positive regulation of endothelial cell proliferation; blood coagulation; positive regulation of cell migration