Proteinase-activated receptor 3 (F2rl2) Recombinant Protein | F2rl2 recombinant protein
Recombinant Mouse Proteinase-activated receptor 3 (F2rl2)
Gene Names
F2rl2; PAR3; F730031A08
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proteinase-activated receptor 3 (F2rl2); Recombinant Mouse Proteinase-activated receptor 3 (F2rl2); F2rl2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
38-369aa; Full length protein
Sequence
SFNGGPQNTFEEFPLSDIEGWTGATTTIKAECPEDSISTLHVNNATIGYLRSSLSTQVIP AIYILLFVVGVPANIVTLWKLSLRTKSISLVIFHTNLAIADLLFCVTLPFKIAYHLNGNN WVFGEVTCRITTVVFYGNMYCAILILTCMGINRYLATAHPFTYQKLPKRSFSMLMCGMVW VMVFLYMLPFVILKQEYHLVHSEITTCHDVVDACESPSSFRFYYFVSLAFFGFLIPFVII IFCYTTLIHKLKSKDRIWLGYIKAVLLILVIFTICFAPTNIILVIHHANYYYHNTDSLYF MYLIALCLGSLNSCLDPFLYFVMSKVVDQLNP
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for F2rl2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41,697 Da
NCBI Official Full Name
proteinase-activated receptor 3
NCBI Official Synonym Full Names
coagulation factor II (thrombin) receptor-like 2
NCBI Official Symbol
F2rl2
NCBI Official Synonym Symbols
PAR3; F730031A08
NCBI Protein Information
proteinase-activated receptor 3
UniProt Protein Name
Proteinase-activated receptor 3
Protein Family
UniProt Gene Name
F2rl2
UniProt Synonym Gene Names
Par3; PAR-3
UniProt Entry Name
PAR3_MOUSE
Uniprot Description
PAR3: a G-protein coupled receptor for activated thrombin or trypsin. Coupled to G proteins that stimulate phosphoinositide hydrolysis. Interacts with INSC/inscuteable and probably GPSM2. Highest expression in the megakaryocytes of the bone marrow, lower in mature megakaryocytes, in platelets and in a variety of other tissues such as heart and gut.
Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral
Cellular Component: apical plasma membrane; integral to membrane; membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity; signal transducer activity; thrombin receptor activity
Biological Process: blood coagulation; G-protein coupled receptor protein signaling pathway; hemostasis; signal transduction
Research Articles on F2rl2
Similar Products
Product Notes
The F2rl2 f2rl2 (Catalog #AAA7014453) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 38-369aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the F2rl2 f2rl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SFNGGPQNTF EEFPLSDIEG WTGATTTIKA ECPEDSISTL HVNNATIGYL RSSLSTQVIP AIYILLFVVG VPANIVTLWK LSLRTKSISL VIFHTNLAIA DLLFCVTLPF KIAYHLNGNN WVFGEVTCRI TTVVFYGNMY CAILILTCMG INRYLATAHP FTYQKLPKRS FSMLMCGMVW VMVFLYMLPF VILKQEYHLV HSEITTCHDV VDACESPSSF RFYYFVSLAF FGFLIPFVII IFCYTTLIHK LKSKDRIWLG YIKAVLLILV IFTICFAPTN IILVIHHANY YYHNTDSLYF MYLIALCLGS LNSCLDPFLY FVMSKVVDQL NP. It is sometimes possible for the material contained within the vial of "Proteinase-activated receptor 3 (F2rl2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
