Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Junctional adhesion molecule A Recombinant Protein | F11r recombinant protein

Junctional adhesion molecule A

Gene Names
F11r; JAM; Jcam; JAM-1; JAM-A; Jcam1; Ly106; ESTM33; AA638916; 9130004G24
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Junctional adhesion molecule A; F11r recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
27-300aa; full length protein
Sequence
KGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVEWKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGEVSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKTRAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIVAAVLVTLILLGLLIFGVWFAYSRGYFERTKKGTAPGKKVIYSQPSTRSEGEFKQTSSFLV
Sequence Length
Full Length Protein
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for F11r recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for F11r recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,424 Da
NCBI Official Full Name
junctional adhesion molecule A
NCBI Official Synonym Full Names
F11 receptor
NCBI Official Symbol
F11r
NCBI Official Synonym Symbols
JAM; Jcam; JAM-1; JAM-A; Jcam1; Ly106; ESTM33; AA638916; 9130004G24
NCBI Protein Information
junctional adhesion molecule A
UniProt Protein Name
Junctional adhesion molecule A
UniProt Gene Name
F11r
UniProt Synonym Gene Names
Jam1; Jcam; Jcam1; JAM-A; JAM-1
UniProt Entry Name
JAM1_MOUSE

Uniprot Description

JAM-A: Seems to play a role in epithelial tight junction formation. Appears early in primordial forms of cell junctions and recruits PARD3. The association of the PARD6-PARD3 complex may prevent the interaction of PARD3 with JAM1, thereby preventing tight junction assembly. Plays a role in regulating monocyte transmigration involved in integrity of epithelial barrier. Involved in platelet activation. In case of orthoreovirus infection, serves as receptor for the virus. Belongs to the immunoglobulin superfamily.

Protein type: Membrane protein, integral; Cell adhesion

Cellular Component: cell junction; cytoplasmic vesicle; intercellular junction; microtubule cytoskeleton; plasma membrane; tight junction

Molecular Function: PDZ domain binding; protein binding

Biological Process: actomyosin structure organization and biogenesis; cell adhesion; epithelial cell differentiation; intestinal absorption; positive regulation of blood pressure; positive regulation of GTPase activity; regulation of cytokine production

Research Articles on F11r

Similar Products

Product Notes

The F11r f11r (Catalog #AAA7042696) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-300aa; full length protein. The amino acid sequence is listed below: KGSVYTAQSD VQVPENESIK LTCTYSGFSS PRVEWKFVQG STTALVCYNS QITAPYADRV TFSSSGITFS SVTRKDNGEY TCMVSEEGGQ NYGEVSIHLT VLVPPSKPTI SVPSSVTIGN RAVLTCSEHD GSPPSEYSWF KDGISMLTAD AKKTRAFMNS SFTIDPKSGD LIFDPVTAFD SGEYYCQAQN GYGTAMRSEA AHMDAVELNV GGIVAAVLVT LILLGLLIFG VWFAYSRGYF ERTKKGTAPG KKVIYSQPST RSEGEFKQTS SFLV. It is sometimes possible for the material contained within the vial of "Junctional adhesion molecule A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.