Exopolysaccharide production protein ExoZ (exoZ) Recombinant Protein | exoZ recombinant protein
Recombinant Rhizobium meliloti Exopolysaccharide production protein ExoZ (exoZ)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Exopolysaccharide production protein ExoZ (exoZ); Recombinant Rhizobium meliloti Exopolysaccharide production protein ExoZ (exoZ); exoZ recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-317
Sequence
MLFHAAEKTGHHFTIGAAGVDVFFVISGFIMWVISDRRSVTPVEFIADRARRIVPVYWLATGVMVAGALAGLFPNLVLTLEHVLASLFFVPARSPSSGEIWPVLVQGWTLNFEMLFYAVFAGSLFMPRNWRLPVVSGLFLALVIAGRVVAFDDAVMLTYTRPVILEFVAGMIIGEFWLKGRVPPLAVGSALFACSLGGFALIGVLGLPFDELTTGPLAVLLVIGVLSLEANGCVRALSLPGLLGDASYSIYLWHTFAISVVAKAGLAIGLGAPATMFAAVLSGTLIGIAAYMMLERPLLRRGRARRVTAGLAGRAAE
Sequence Length
317
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for exoZ recombinant protein
exoZ
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,821 Da
NCBI Official Full Name
acetyltransferase
NCBI Official Symbol
exoZ
NCBI Protein Information
acetyltransferase
UniProt Protein Name
Exopolysaccharide production protein ExoZ
Protein Family
UniProt Gene Name
exoZ
UniProt Entry Name
EXOZ_RHIME
Uniprot Description
Function: Required for the acetyl modification of the third sugar (glucose) of the octasaccharide subunit of succinoglycan (EPS I).
Subcellular location: Cell membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the acyltransferase 3 family.
Similar Products
Product Notes
The exoZ exoz (Catalog #AAA1160467) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-317. The amino acid sequence is listed below: MLFHAAEKTG HHFTIGAAGV DVFFVISGFI MWVISDRRSV TPVEFIADRA RRIVPVYWLA TGVMVAGALA GLFPNLVLTL EHVLASLFFV PARSPSSGEI WPVLVQGWTL NFEMLFYAVF AGSLFMPRNW RLPVVSGLFL ALVIAGRVVA FDDAVMLTYT RPVILEFVAG MIIGEFWLKG RVPPLAVGSA LFACSLGGFA LIGVLGLPFD ELTTGPLAVL LVIGVLSLEA NGCVRALSLP GLLGDASYSI YLWHTFAISV VAKAGLAIGL GAPATMFAAV LSGTLIGIAA YMMLERPLLR RGRARRVTAG LAGRAAE. It is sometimes possible for the material contained within the vial of "Exopolysaccharide production protein ExoZ (exoZ), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
