Succinoglycan biosynthesis transport protein exoP (exoP) Recombinant Protein | exoP recombinant protein
Recombinant Rhizobium meliloti Succinoglycan biosynthesis transport protein exoP (exoP)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Succinoglycan biosynthesis transport protein exoP (exoP); Recombinant Rhizobium meliloti Succinoglycan biosynthesis transport protein exoP (exoP); exoP recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-786aa; full length protein
Sequence
MNRTAPMKQRSVPLSSIMPSEEQSDGFIDLDRLVAAVFRRARLVAAFVVLFIALGAAYLL FATPYYTSMTQILLDENLSKYAEEEPTPVNSQMLDTQIASAVEILKSGELALRVVDKLKL SENDTILNPPRSPVDMVKEWLKTATGLFSGGPDVTEEAARNGRRQKAAAIIQQSLAVERV SRSSVVAVAFRSSDPLLAATIARGYASAYLTDQLNANFEATERASVWLQERLTDLQQRSQ AAALEVAHFRAENGLTAARGELMSEQQMADLNSQLIVAQADTASASARYDQYKSIVDQGP ENAVKNATISSKEGDNSVIRDLRTRYLTVGKREREVSDNFGADHPQAVSLRAEQEDVARQ IYQELQQLTASYKNEYEVAQSREESLRKSIQGIAGKTSDASEQLVQLRELEQKAAALKTL YESYLGRYEQATQQQSFPIAKARVISEAGVPVSPSSPKKTMTLALSAVLGMMVGGAYAAF LEFRERTFRLEGNIRSILGHRSLGYVPLLGTRMKKKAQLVHAHFGSVKRHDEAVDDTMPF QRLSRIVVDAPRSTFAETFRNAKLACDQMLAGSESRVIAIASALPDEGKSIIAANFAALL AASGKRTLLIDADIRKPGLTQMITPAPRTGLVETLIGEASWPAGIKVDQRTKLAILPAGG ASHQRHQSNELLASPAMANLIENARNAFDYVVVDLAALAPVVDAKAFAPLADGILFVVEW GRTPSRLVRDLLHSEPLINSKVLGVILNKTDMNELGKYSDFDGAEKYRHRYGKYYVENTI TENTAA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for exoP recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86,124 Da
NCBI Official Full Name
protein tyrosine kinase MPA1 family protein (plasmid)
NCBI Official Symbol
exoP
NCBI Protein Information
protein tyrosine kinase MPA1 family protein
UniProt Protein Name
Succinoglycan biosynthesis transport protein ExoP
Protein Family
UniProt Gene Name
exoP
UniProt Entry Name
EXOP_RHIME
Similar Products
Product Notes
The exoP exop (Catalog #AAA7014432) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-786aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the exoP exop for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNRTAPMKQR SVPLSSIMPS EEQSDGFIDL DRLVAAVFRR ARLVAAFVVL FIALGAAYLL FATPYYTSMT QILLDENLSK YAEEEPTPVN SQMLDTQIAS AVEILKSGEL ALRVVDKLKL SENDTILNPP RSPVDMVKEW LKTATGLFSG GPDVTEEAAR NGRRQKAAAI IQQSLAVERV SRSSVVAVAF RSSDPLLAAT IARGYASAYL TDQLNANFEA TERASVWLQE RLTDLQQRSQ AAALEVAHFR AENGLTAARG ELMSEQQMAD LNSQLIVAQA DTASASARYD QYKSIVDQGP ENAVKNATIS SKEGDNSVIR DLRTRYLTVG KREREVSDNF GADHPQAVSL RAEQEDVARQ IYQELQQLTA SYKNEYEVAQ SREESLRKSI QGIAGKTSDA SEQLVQLREL EQKAAALKTL YESYLGRYEQ ATQQQSFPIA KARVISEAGV PVSPSSPKKT MTLALSAVLG MMVGGAYAAF LEFRERTFRL EGNIRSILGH RSLGYVPLLG TRMKKKAQLV HAHFGSVKRH DEAVDDTMPF QRLSRIVVDA PRSTFAETFR NAKLACDQML AGSESRVIAI ASALPDEGKS IIAANFAALL AASGKRTLLI DADIRKPGLT QMITPAPRTG LVETLIGEAS WPAGIKVDQR TKLAILPAGG ASHQRHQSNE LLASPAMANL IENARNAFDY VVVDLAALAP VVDAKAFAPL ADGILFVVEW GRTPSRLVRD LLHSEPLINS KVLGVILNKT DMNELGKYSD FDGAEKYRHR YGKYYVENTI TENTAA. It is sometimes possible for the material contained within the vial of "Succinoglycan biosynthesis transport protein exoP (exoP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
