Protein C-ets-1 (ETS1) Recombinant Protein | ETS1 recombinant protein

Recombinant Human Protein C-ets-1 (ETS1)

Cat. Num. AAA718477

• Gene Names: ETS1; p54; ETS-1; EWSR2; c-ets-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Protein C-ets-1 (ETS1); Recombinant Human Protein C-ets-1 (ETS1); ETS1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-441, Full length protein
• Sequence: MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE
• Sequence Length: 441

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 219689118
• NCBI GeneID: 2113
• NCBI Accession #: NP_001137292.1
• NCBI GenBank Nucleotide #: NM_001143820.1
• UniProt Accession #: P14921; Q14278; Q16080; Q6N087; Q96AC5; A9UL17; F5GYX9
• Molecular Weight: 30,860 Da
• NCBI Official Full Name: protein C-ets-1 isoform 1
• NCBI Official Synonym Full Names: ETS proto-oncogene 1, transcription factor
• NCBI Official Symbol: ETS1
• NCBI Official Synonym Symbols: p54; ETS-1; EWSR2; c-ets-1
• NCBI Protein Information: protein C-ets-1
• UniProt Protein Name: Protein C-ets-1
• Protein Family: Protein
• UniProt Gene Name: ETS1
• UniProt Synonym Gene Names: EWSR2

NCBI Description

This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]

Uniprot Description

Transcription factor. Directly controls the expression of cytokine and chemokine genes in a wide variety of different cellular contexts. May control the differentiation, survival and proliferation of lymphoid cells. May also regulate angiogenesis through regulation of expression of genes controlling endothelial cell migration and invasion.