Ethylene receptor 2 (ETR2) Recombinant Protein | ETR2 recombinant protein
Recombinant Arabidopsis thaliana Ethylene receptor 2 (ETR2)
Gene Names
ETR2; ethylene response 2; ETR2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ethylene receptor 2 (ETR2); Recombinant Arabidopsis thaliana Ethylene receptor 2 (ETR2); ETR2 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-773aa; full length protein
Sequence
MVKEIASWLLILSMVVFVSPVLAINGGGYPRCNCEDEGNSFWSTENILETQRVSDFLIAV AYFSIPIELLYFVSCSNVPFKWVLFEFIAFIVLCGMTHLLHGWTYSAHPFRLMMAFTVFK MLTALVSCATAITLITLIPLLLKVKVREFMLKKKAHELGREVGLILIKKETGFHVRMLTQ EIRKSLDRHTILYTTLVELSKTLGLQNCAVWMPNDGGTEMDLTHELRGRGGYGGCSVSME DLDVVRIRESDEVNVLSVDSSIARASGGGGDVSEIGAVAAIRMPMLRVSDFNGELSYAIL VCVLPGGTPRDWTYQEIEIVKVVADQVTVALDHAAVLEESQLMREKLAEQNRALQMAKRD ALRASQARNAFQKTMSEGMRRPMHSILGLLSMIQDEKLSDEQKMIVDTMVKTGNVMSNLV GDSMDVPDGRFGTEMKPFSLHRTIHEAACMARCLCLCNGIRFLVDAEKSLPDNVVGDERR VFQVILHIVGSLVKPRKRQEGSSLMFKVLKERGSLDRSDHRWAAWRSPASSADGDVYIRF EMNVENDDSSSQSFASVSSRDQEVGDVRFSGGYGLGQDLSFGVCKKVVQLIHGNISVVPG SDGSPETMSLLLRFRRRPSISVHGSSESPAPDHHAHPHSNSLLRGLQVLLVDTNDSNRAV TRKLLEKLGCDVTAVSSGFDCLTAIAPGSSSPSTSFQVVVLDLQMAEMDGYEVAMRIRSR SWPLIVATTVSLDEEMWDKCAQIGINGVVRKPVVLRAMESELRRVLLQADQLL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for ETR2 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
85,613 Da
NCBI Official Full Name
ethylene receptor 2
NCBI Official Symbol
ETR2
NCBI Official Synonym Symbols
ethylene response 2; ETR2
NCBI Protein Information
ethylene receptor 2
UniProt Protein Name
Ethylene receptor 2
Protein Family
UniProt Gene Name
ETR2
UniProt Synonym Gene Names
AtETR2
UniProt Entry Name
ETR2_ARATH
NCBI Description
Involved in ethylene perception in Arabidopsis
Uniprot Description
Ethylene receptor related to bacterial two-component regulators. Acts as a redundant negative regulator of ethylene signaling.
Research Articles on ETR2
Similar Products
Product Notes
The ETR2 etr2 (Catalog #AAA7014404) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-773aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the ETR2 etr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVKEIASWLL ILSMVVFVSP VLAINGGGYP RCNCEDEGNS FWSTENILET QRVSDFLIAV AYFSIPIELL YFVSCSNVPF KWVLFEFIAF IVLCGMTHLL HGWTYSAHPF RLMMAFTVFK MLTALVSCAT AITLITLIPL LLKVKVREFM LKKKAHELGR EVGLILIKKE TGFHVRMLTQ EIRKSLDRHT ILYTTLVELS KTLGLQNCAV WMPNDGGTEM DLTHELRGRG GYGGCSVSME DLDVVRIRES DEVNVLSVDS SIARASGGGG DVSEIGAVAA IRMPMLRVSD FNGELSYAIL VCVLPGGTPR DWTYQEIEIV KVVADQVTVA LDHAAVLEES QLMREKLAEQ NRALQMAKRD ALRASQARNA FQKTMSEGMR RPMHSILGLL SMIQDEKLSD EQKMIVDTMV KTGNVMSNLV GDSMDVPDGR FGTEMKPFSL HRTIHEAACM ARCLCLCNGI RFLVDAEKSL PDNVVGDERR VFQVILHIVG SLVKPRKRQE GSSLMFKVLK ERGSLDRSDH RWAAWRSPAS SADGDVYIRF EMNVENDDSS SQSFASVSSR DQEVGDVRFS GGYGLGQDLS FGVCKKVVQL IHGNISVVPG SDGSPETMSL LLRFRRRPSI SVHGSSESPA PDHHAHPHSN SLLRGLQVLL VDTNDSNRAV TRKLLEKLGC DVTAVSSGFD CLTAIAPGSS SPSTSFQVVV LDLQMAEMDG YEVAMRIRSR SWPLIVATTV SLDEEMWDKC AQIGINGVVR KPVVLRAMES ELRRVLLQAD QLL. It is sometimes possible for the material contained within the vial of "Ethylene receptor 2 (ETR2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
