Growth Hormone Active Protein | rtGH active protein
Recombinant Rainbow Trout Growth Hormone
Purity
Greater than 95.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE
Synonyms
Growth Hormone; Recombinant Rainbow Trout Growth Hormone; GH1; GH; GHN; GH-N; hGH-N; Pituitary growth hormone; Growth hormone 1; Somatotropin; GH Rainbow Trout; Growth Hormone Rainbow Trout (Oncorhynchus mykiss) Recombinant; rtGH active protein
Host
Escherichia Coli
Purity/Purification
Greater than 95.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE
Form/Format
Sterile filtered white lyophilized (freeze-dried) powder
Protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3. Adjusted to pH-8
Protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3. Adjusted to pH-8
Sequence
AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL
Sequence Length
210
Biological Activity
Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH
Solubility
It is recommended to reconstitute the lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) in 0.4% NaHCO3 or water adjusted to pH 8-9, not less than 100ug/ml and not more than 3mg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar
Preparation and Storage
Although stable at room temperature for at least two weeks, should be stored desiccated below-18 degree C.
Upon reconstitution and filter sterilization GH can be stored at 4 degree C, pH 9 for up to 4 weeks.
For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles
Upon reconstitution and filter sterilization GH can be stored at 4 degree C, pH 9 for up to 4 weeks.
For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles
Related Product Information for rtGH active protein
Description: Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 188 amino acids with an additional Ala at the N-terminus and having a molecular mass of 21, 535 Dalton. The Rainbow Trout (Oncorhynchus mykiss) Growth-Hormone Recombinant is purified by proprietary chromatographic techniques.
Introduction: GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.
Introduction: GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.
Product Categories/Family for rtGH active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
23,795 Da
NCBI Official Full Name
Somatotropin-1
NCBI Official Symbol
gh1
NCBI Protein Information
somatotropin-1
UniProt Protein Name
Somatotropin-1
Protein Family
UniProt Gene Name
gh1
Uniprot Description
Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation.
Research Articles on rtGH
Similar Products
Product Notes
The rtGH gh1 (Catalog #AAA147037) is an Active Protein produced from Escherichia Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AIENQRLFNI AVSRVQHLHL LAQKMFNDFD GTLLPDERRQ LNKIFLLDFC NSDSIVSPVD KHETQKSSVL KLLHISFRLI ESWEYPSQTL IISNSLMVRN ANQISEKLSD LKVGINLLIT GSQDGVLSLD DNDSQQLPPY GNYYQNLGGD GNVRRNYELL ACFKKDMHKV ETYLTVAKCR KSLEANCTL. It is sometimes possible for the material contained within the vial of "Growth Hormone, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
