Transmembrane protein C6orf70 (C6orf70) Recombinant Protein | C6orf70 recombinant protein
Recombinant Human Transmembrane protein C6orf70 (C6orf70)
Gene Names
ERMARD; PVNH6; C6orf70; dJ266L20.3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Transmembrane protein C6orf70 (C6orf70); Recombinant Human Transmembrane protein C6orf70 (C6orf70); C6orf70 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-678aa; full length protein
Sequence
MEVLIGDPITTCLSPSVYDIICNLGFQLRENCDINSIVTQNGEVCWKTITDCVSYTESEQ GLDYWGSVRLLGPVCEAVHSHFLSLTKGQFEIRYAPWFQWTSFPELFPEIFDALESLQSP AISLSLMKLTSCLERALGDVFLLIGKECPFLLRDLLSSEELAQVFSQSVMNVLKVFVGSP CGLNLRNVLWHGFASPEEIPPKYCSMMILLTAGLGQLLKSYLQNTKLTLAHRSFISLTNL EDLIVFPDVTYEVLSVLEEVMMKSAFILKIMLPYWEVALVKFKSHRFADCAILLLTQLET GLRNVFATLNRCPKRLLTAESTALYTTFDQILAKHLNDGKINQLPLFLGEPAMEFLWDFL NHQEGPRIRDHLSHGEINLHEFSKETTNQLLAFSLVLLLRFVDDCLLSVFKEKSAVELLI SLAEGYSSRCHPVFQLKKQVLSCEESIRVWALLPFPEELTRQAVRLEDNSETNACHSLIT KMTDELYHHMPENRCVLKDLDRLPTETWPQLLRELCSTPVPTLFCPRIVLEVLVVLRSIS EQCRRVSSQVTVASELRHRQWVERTLRSRQRQNYLRMWSSIRLLSPVLSLILLLIALELV NIHAVCGKNAHEYQQYLKFVKSILQYTENLVAYTSYEKNKWNETINLTHTALLKMWTFSE KKQMLIHLAKKSTSKVLL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for C6orf70 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
63,591 Da
NCBI Official Full Name
endoplasmic reticulum membrane-associated RNA degradation protein isoform 2
NCBI Official Synonym Full Names
ER membrane-associated RNA degradation
NCBI Official Symbol
ERMARD
NCBI Official Synonym Symbols
PVNH6; C6orf70; dJ266L20.3
NCBI Protein Information
endoplasmic reticulum membrane-associated RNA degradation protein
UniProt Protein Name
Endoplasmic reticulum membrane-associated RNA degradation protein
UniProt Gene Name
ERMARD
UniProt Synonym Gene Names
C6orf70; ER membrane-associated RNA degradation protein
UniProt Entry Name
EMARD_HUMAN
NCBI Description
The protein encoded by this gene contains 2 transmembrane domains near the C-terminus and is localized in the endoplasmic reticulum. Knockout of this gene in developing rat brain showed that it may be involved in neuronal migration. Mutations in this gene are associated with periventricular nodular heterotopia-6 (PVNH6). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2013]
Uniprot Description
ERMARD: 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 6q27
Cellular Component: endoplasmic reticulum membrane; integral to membrane
Biological Process: multicellular organismal development
Disease: Periventricular Nodular Heterotopia 6
Research Articles on C6orf70
Similar Products
Product Notes
The C6orf70 ermard (Catalog #AAA7010599) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-678aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the C6orf70 ermard for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEVLIGDPIT TCLSPSVYDI ICNLGFQLRE NCDINSIVTQ NGEVCWKTIT DCVSYTESEQ GLDYWGSVRL LGPVCEAVHS HFLSLTKGQF EIRYAPWFQW TSFPELFPEI FDALESLQSP AISLSLMKLT SCLERALGDV FLLIGKECPF LLRDLLSSEE LAQVFSQSVM NVLKVFVGSP CGLNLRNVLW HGFASPEEIP PKYCSMMILL TAGLGQLLKS YLQNTKLTLA HRSFISLTNL EDLIVFPDVT YEVLSVLEEV MMKSAFILKI MLPYWEVALV KFKSHRFADC AILLLTQLET GLRNVFATLN RCPKRLLTAE STALYTTFDQ ILAKHLNDGK INQLPLFLGE PAMEFLWDFL NHQEGPRIRD HLSHGEINLH EFSKETTNQL LAFSLVLLLR FVDDCLLSVF KEKSAVELLI SLAEGYSSRC HPVFQLKKQV LSCEESIRVW ALLPFPEELT RQAVRLEDNS ETNACHSLIT KMTDELYHHM PENRCVLKDL DRLPTETWPQ LLRELCSTPV PTLFCPRIVL EVLVVLRSIS EQCRRVSSQV TVASELRHRQ WVERTLRSRQ RQNYLRMWSS IRLLSPVLSL ILLLIALELV NIHAVCGKNA HEYQQYLKFV KSILQYTENL VAYTSYEKNK WNETINLTHT ALLKMWTFSE KKQMLIHLAK KSTSKVLL. It is sometimes possible for the material contained within the vial of "Transmembrane protein C6orf70 (C6orf70), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
