Delta (24 (24 (1)))-sterol reductase Recombinant Protein | ERG4 recombinant protein
Recombinant Saccharomyces cerevisiae Delta (24 (24 (1)))-sterol reductase
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Delta (24 (24 (1)))-sterol reductase; Recombinant Saccharomyces cerevisiae Delta (24 (24 (1)))-sterol reductase; Recombinant Delta (24 (24 (1)))-sterol reductase; Delta(24(24(1)))-sterol reductase EC= 1.3.1.71; C-24(28) sterol reductase Sterol Delta(24(28))-reductase; ERG4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-473
Sequence
MAKDNSEKLQVQGEEKKSKQPVNFLPQGKWLKPNEIEYEFGGTTGVIGMLIGFPLLMYYMWICAEFYHGKVALPKAGESWMHFIKHLYQLVLENGIPEKYDWTIFLTFWVFQIIFYYTLPGIWTKGQPLSHLKGKQLPYFCNAMWTLYVTTTLVLVLHFTNLFRLYVIIDRFGRIMTCAIISGFAFSIILYLWTLFISHDYHRMTGNHLYDFFMGAPLNPRWGILDLKMFFEVRLPWFTLYFITLGACLKQWETYGYVTPQLGVVMLAHWLYANACAKGEELIVPTWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLYYHDPSEYHWSTLYNVSLYVVLLCAYYFFDTANAQKNAFRKQMSGDKTGRKTFPFLPYQILKNPKYMVTSNGSYLLIDGWYTLARKIHYTADWTQSLVWALSCGFNSVFPWFFPVFFLVVLIHRAFRDQAKCKRKYGKDWDEYCKHCPYVFIPYVF
Sequence Length
473
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
56,040 Da
NCBI Official Full Name
Erg4p
NCBI Official Symbol
ERG4
NCBI Protein Information
Erg4p
UniProt Protein Name
Delta(24(24(1)))-sterol reductase
Protein Family
UniProt Gene Name
ERG4
UniProt Entry Name
ERG4_YEAST
Uniprot Description
Catalytic activity: Ergosterol + NADP+ = ergosta-5,7,22,24(241)-tetraen-3-beta-ol + NADPH.
Pathway: Steroid metabolism; ergosterol biosynthesis; ergosterol from zymosterol: step 5/5.
Subcellular location: Membrane; Multi-pass membrane protein.
Miscellaneous: Present with 1640 molecules/cell in log phase SD medium.
Sequence similarities: Belongs to the ERG4/ERG24 family.
Caution: Was originally (Ref.1) thought to be a transport protein.
Similar Products
Product Notes
The ERG4 erg4 (Catalog #AAA1252069) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-473. The amino acid sequence is listed below: MAKDNSEKLQ VQGEEKKSKQ PVNFLPQGKW LKPNEIEYEF GGTTGVIGML IGFPLLMYYM WICAEFYHGK VALPKAGESW MHFIKHLYQL VLENGIPEKY DWTIFLTFWV FQIIFYYTLP GIWTKGQPLS HLKGKQLPYF CNAMWTLYVT TTLVLVLHFT NLFRLYVIID RFGRIMTCAI ISGFAFSIIL YLWTLFISHD YHRMTGNHLY DFFMGAPLNP RWGILDLKMF FEVRLPWFTL YFITLGACLK QWETYGYVTP QLGVVMLAHW LYANACAKGE ELIVPTWDMA YEKFGFMLIF WNIAGVPYTY CHCTLYLYYH DPSEYHWSTL YNVSLYVVLL CAYYFFDTAN AQKNAFRKQM SGDKTGRKTF PFLPYQILKN PKYMVTSNGS YLLIDGWYTL ARKIHYTADW TQSLVWALSC GFNSVFPWFF PVFFLVVLIH RAFRDQAKCK RKYGKDWDEY CKHCPYVFIP YVF. It is sometimes possible for the material contained within the vial of "Delta (24 (24 (1)))-sterol reductase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
