Ethylene-responsive transcription factor ERF115 (ERF115) Recombinant Protein | ERF115 recombinant protein
Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor ERF115 (ERF115)
Gene Names
AT5G07310; ERF115; ETHYLENE RESPONSE FACTOR 115; T2I1.20; T2I1_20
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ethylene-responsive transcription factor ERF115 (ERF115); Recombinant Arabidopsis thaliana Ethylene-responsive transcription factor ERF115 (ERF115); ERF115 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-263, Full length protein
Sequence
MANSGNYGKRPFRGDESDEKKEADDDENIFPFFSARSQYDMRAMVSALTQVIGNQSSSHDNNQHQPVVYNQQDPNPPAPPTQDQGLLRKRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAALAYDNAALKFKGSKAKLNFPERAQLASNTSTTTGPPNYYSSNNQIYYSNPQTNPQTIPYFNQYYYNQYLHQGGNSNDALSYSLAGGETGGSMYNHQTLSTTNSSSSGGSSRQQDDEQDYARYLRFGDSSPPNSGF
Sequence Length
263
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,406 Da
NCBI Official Full Name
Integrase-type DNA-binding superfamily protein
NCBI Official Symbol
AT5G07310
NCBI Official Synonym Symbols
ERF115; ETHYLENE RESPONSE FACTOR 115; T2I1.20; T2I1_20
NCBI Protein Information
Integrase-type DNA-binding superfamily protein
UniProt Protein Name
Ethylene-responsive transcription factor ERF115
Protein Family
UniProt Gene Name
ERF115
NCBI Description
encodes a member of the ERF (ethylene response factor) subfamily B-4 of ERF/AP2 transcription factor family. The protein contains one AP2 domain. There are 7 members in this subfamily.
Uniprot Description
Acts as a transcriptional activator of the phytosulfokine PSK5 peptide hormone. Binds to the GCC-box pathogenesis-related promoter element. Rate-limiting factor of quiescent center cell division active when surrounding stem cells are damaged. Is a proteolytic target of APC/C-FZR1 complex.
Research Articles on ERF115
Similar Products
Product Notes
The ERF115 erf115 (Catalog #AAA1297564) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-263, Full length protein. The amino acid sequence is listed below: MANSGNYGKR PFRGDESDEK KEADDDENIF PFFSARSQYD MRAMVSALTQ VIGNQSSSHD NNQHQPVVYN QQDPNPPAPP TQDQGLLRKR HYRGVRQRPW GKWAAEIRDP QKAARVWLGT FETAEAAALA YDNAALKFKG SKAKLNFPER AQLASNTSTT TGPPNYYSSN NQIYYSNPQT NPQTIPYFNQ YYYNQYLHQG GNSNDALSYS LAGGETGGSM YNHQTLSTTN SSSSGGSSRQ QDDEQDYARY LRFGDSSPPN SGF. It is sometimes possible for the material contained within the vial of "Ethylene-responsive transcription factor ERF115 (ERF115), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
