Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

GTPase ERas Recombinant Protein | ERAS recombinant protein

Recombinant Human GTPase ERas

Gene Names
ERAS; HRAS2; HRASP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GTPase ERas; Recombinant Human GTPase ERas; Embryonic stem cell-expressed Ras; ERAS recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
3-230. Partial
Sequence
LPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGC
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for ERAS recombinant protein
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of embryonic st cells.
Product Categories/Family for ERAS recombinant protein
References
Role of Eras in promoting tumor-like properties in mouse embryonic stem cells.Takahashi K., Mitsui K., Yamanaka S.Nature 423:541-545(2003)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28.8 kDa
NCBI Official Full Name
GTPase ERas
NCBI Official Synonym Full Names
ES cell expressed Ras
NCBI Official Symbol
ERAS
NCBI Official Synonym Symbols
HRAS2; HRASP
NCBI Protein Information
GTPase ERas
UniProt Protein Name
GTPase ERas
Protein Family
UniProt Gene Name
ERAS
UniProt Synonym Gene Names
HRAS2; HRASP; E-Ras
UniProt Entry Name
RASE_HUMAN

NCBI Description

This gene encodes a constitutively active member of the small GTPase Ras protein family. The encoded protein activates the phosphatidylinositol 3-kinase signal transduction pathway in undifferentiated stem cells, but is not expressed in differentiated cells. This gene may be involved in cancer and chemotherapy resistance. [provided by RefSeq, Dec 2012]

Uniprot Description

ERas: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of embryonic stem cells. Belongs to the small GTPase superfamily. Ras family.

Protein type: G protein, monomeric; G protein, monomeric, Ras; G protein

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: intracellular; plasma membrane

Molecular Function: GTP binding

Biological Process: small GTPase mediated signal transduction

Research Articles on ERAS

Similar Products

Product Notes

The ERAS eras (Catalog #AAA960501) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 3-230. Partial. The amino acid sequence is listed below: LPTKPGTFDL GLATWSPSFQ GETHRAQARR RDVGRQLPEY KAVVVGASGV GKSALTIQLN HQCFVEDHDP TIQDSYWKEL TLDSGDCILN VLDTAGQAIH RALRDQCLAV CDGVLGVFAL DDPSSLIQLQ QIWATWGPHP AQPLVLVGNK CDLVTTAGDA HAAAAALAHS WGAHFVETSA KTRQGVEEAF SLLVHEIQRV QEAMAKEPMA RSCREKTRHQ KATCHCGC . It is sometimes possible for the material contained within the vial of "GTPase ERas, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.