Western Blot (WB)
(Western Blot analysis of NXT1 expression in transfected 293T cell line by NXT1 polyclonal antibody. Lane 1: NXT1 transfected lysate (15.51kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human NXT1 Polyclonal Antibody | anti-NXT1 antibody
NXT1 (NTF2-related Export Protein 1, Protein p15, MTR2) (Biotin)
Gene Names
NXT1; P15; MTR2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NXT1; Polyclonal Antibody; NXT1 (NTF2-related Export Protein 1; Protein p15; MTR2) (Biotin); anti-NXT1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NXT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
972
Applicable Applications for anti-NXT1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NXT1, aa1-140 (AAH00759.1).
Immunogen Sequence
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of NXT1 expression in transfected 293T cell line by NXT1 polyclonal antibody. Lane 1: NXT1 transfected lysate (15.51kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of NXT1 expression in transfected 293T cell line by NXT1 polyclonal antibody. Lane 1: NXT1 transfected lysate (15.51kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NXT1 antibody
The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)-and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN-and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. The encoded protein heterodimerizes with Tap protein and may regulate the ability of Tap protein to mediate nuclear mRNA export. The use of alternate polyadenylation sites has been found for this gene.
Product Categories/Family for anti-NXT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens NTF2-like export factor 1, mRNA
NCBI Official Synonym Full Names
nuclear transport factor 2 like export factor 1
NCBI Official Symbol
NXT1
NCBI Official Synonym Symbols
P15; MTR2
NCBI Protein Information
NTF2-related export protein 1
Protein Family
NCBI Description
The protein encoded by this gene is located in the nuclear envelope. It has protein similarity to nuclear transport factor 2. This protein functions as a nuclear export factor in both RAN (Ras-related nuclear protein)- and CRM1 (required for chromosome region maintenance)-dependent pathways. It is found to stimulate the export of U1 snRNA in RAN- and CRM1-dependent pathways and the export of tRNA and mRNA in a CRM1-independent pathway. The encoded protein heterodimerizes with Tap protein and may regulate the ability of Tap protein to mediate nuclear mRNA export. The use of alternate polyadenylation sites has been found for this gene. [provided by RefSeq, Jul 2008]
Research Articles on NXT1
Similar Products
Product Notes
The NXT1 (Catalog #AAA6387867) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NXT1 (NTF2-related Export Protein 1, Protein p15, MTR2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NXT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NXT1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NXT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
