EPIDERMAL PATTERNING FACTOR-like protein 6 (EPFL6) Recombinant Protein | EPFL6 recombinant protein

Recombinant Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 6 (EPFL6)

Cat. Num. AAA1413512

• Gene Names: CHAL; CHALLAH; EPF1-like 6; EPFL6; T9D9.18; T9D9_18
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: EPIDERMAL PATTERNING FACTOR-like protein 6 (EPFL6); Recombinant Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 6 (EPFL6); EPFL6 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 48-156, Full length protein
• Sequence: TFTITPTSTSSPYNRNSNSGTLGNFYAKEEGKSTVVIKKTRKIGDRSKEAELRRILRGLGSSPPRCSSKCGRCTPCKPVHVPVPPGTPVTAEYYPEAWRCKCGNKLYMP
• Sequence Length: 109

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 334184578
• NCBI GeneID: 817587
• NCBI Accession #: NP_001189638.1
• NCBI GenBank Nucleotide #: NM_001202709.2
• UniProt Accession #: Q1PEY6; O22933
• Molecular Weight: 14,085 Da
• NCBI Official Full Name: allergen-like protein
• NCBI Official Symbol: CHAL
• NCBI Official Synonym Symbols: CHALLAH; EPF1-like 6; EPFL6; T9D9.18; T9D9_18
• NCBI Protein Information: allergen-like protein
• UniProt Protein Name: EPIDERMAL PATTERNING FACTOR-like protein 6
• Protein Family: EPIDERMAL PATTERNING FACTOR-like protein
• UniProt Gene Name: EPFL6
• UniProt Synonym Gene Names: EPF-like protein 6

NCBI Description

Encodes a small, potentially secreted protein that acts as an inhibitor of stomatal production though likely not through direct interaction with the TMM receptor. It is homologous to known stomatal regulators EPF1 and EPF2.

Uniprot Description

Acts primarily as positive regulator of inflorescence growth. Endodermal expression is sufficient for proper inflorescence architecture (PubMed:22474391). Redundantly involved with EPFL4 in procambial development regulation. Acts also as tissue-specific regulator of epidermal pattern. Controls stomatal patterning by repressing stomatal production. TMM (AC Q9SSD1) functions to dampen or block CHAL signaling. Not processed by SDD1 (AC O64495). Acts as growth-regulatory ligand for ERECTA family receptors.