Testing Data
Endomucin Recombinant Protein | Emcn recombinant protein
Mouse Endomucin
Gene Names
Emcn; Muc14; AI315669; 0610012K22Rik
Reactivity
Mouse
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
Endomucin; Mouse Endomucin; Recombinant Mouse Soluble Endomucin; Endomucin-1/2; Mucin-14; Muc-14; Emcn recombinant protein
Host
E Coli
Reactivity
Mouse
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
EDGKDVQNDSIPTPAETSTTKASVTIPGIVSVTNPNKPADGTPPEGTTKS DVSQTSLVTTINSLTTPKHEVGTTTEGPLRNESSTMKITVPNTPTSNANS TLPGSQNKTENQSSIRTTEISVTTQLLDALPKITATSSASLTTAHTMSLL QDTEDRKIATTPSTTPSYSSTRHHHHHH
Sequence Length
178
N Terminal Sequence
EDGKDVQND
Buffer
10mM NaP, pH 7.0
Preparation and Storage
The material is stable for greater than six months at -20 degree C to -70 degree C. After the first thawing it is recommended to aliquote the material, because repeated freeze-thaw cycles will decrease the activity.
Testing Data
Testing Data
Related Product Information for Emcn recombinant protein
Endomucin (endothelial sialomucin; also Endomucin-1/2 and Mucin-14) is an 80 - 120 kDa glycoprotein member of the Endomucin family of proteins. It is expressed on endothelial cells and depending upon its glycosylation pattern, can serve as either a pro- or anti-adhesive molecule. Mouse Endomucin precursor is 261 amino acids in length. It is type I transmembrane protein that contains a 170 aa extracellular domain (ECD) (aa 21 - 190) and a 50 aa cytoplasmic region. Three splice variants exist in the ECD. One shows a deletion of aa 91 - 141, a second shows a one aa substitution for aa 91 - 129, and a third shows a one aa substitution for aa 129 - 142. Over aa 21 - 90, mouse Endomucin shares 60% and 30% aa identity with rat and human Endomucin, respectively. The sequence corresponds to Glu20 to Ser190. A 6x His-tag is fused to the C-terminal end of the recombinant mouse soluble Endomucin.
Product Categories/Family for Emcn recombinant protein
References
1.Kinoshita M et al, FEBS Lett 499 (1-2): 121, 2001 2.Kuhn A et al, J Invest Dermatol 119:1388, 2002 3. Matsubara A et al, J Exp Medicine 202:1483, 2005 4. Brachtendorf G et al, Dev Dyn 222:410, 2001 5. Morgan SM et al, Blood 93:165, 1999 6. Samulowitz U et al, Am J Path 160:1669, 2002
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
~18,78 kDa (Monomer)
NCBI Official Full Name
endomucin isoform 1
NCBI Official Synonym Full Names
endomucin
NCBI Official Symbol
Emcn
NCBI Official Synonym Symbols
Muc14; AI315669; 0610012K22Rik
NCBI Protein Information
endomucin; MUC-14; mucin-14; endomucin-1; endomucin-1/2; mucin 14, endothelial
UniProt Protein Name
Endomucin
Protein Family
UniProt Gene Name
Emcn
UniProt Synonym Gene Names
Muc14; MUC-14
UniProt Entry Name
MUCEN_MOUSE
Uniprot Description
Function: Endothelial sialomucin, also called endomucin or mucin-like sialoglycoprotein, which interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix
By similarity.
Subcellular location: Membrane; Single-pass type I membrane protein
Potential.
Tissue specificity: Highly expressed in heart and kidney, followed by brain, spleen, thymus, liver and lung. Exclusively expressed in endothelial cells. Ref.2
Post-translational modification: Highly O-glycosylated. Sialic acid-rich glycoprotein. Ref.1 Ref.2
Similar Products
Product Notes
The Emcn emcn (Catalog #AAA691715) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Mouse Endomucin reacts with Mouse and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: EDGKDVQNDS IPTPAETSTT KASVTIPGIV SVTNPNKPAD GTPPEGTTKS DVSQTSLVTT INSLTTPKHE VGTTTEGPLR NESSTMKITV PNTPTSNANS TLPGSQNKTE NQSSIRTTEI SVTTQLLDAL PKITATSSAS LTTAHTMSLL QDTEDRKIAT TPSTTPSYSS TRHHHHHH. It is sometimes possible for the material contained within the vial of "Endomucin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
