Elongation of very long chain fatty acids protein 7 (ELOVL7) Recombinant Protein | ELOVL7 recombinant protein
Recombinant Bovine Elongation of very long chain fatty acids protein 7 (ELOVL7)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Elongation of very long chain fatty acids protein 7 (ELOVL7); Recombinant Bovine Elongation of very long chain fatty acids protein 7 (ELOVL7); Recombinant Elongation of very long chain fatty acids protein 7 (ELOVL7); Elongation of very long chain fatty acids protein 7 EC= 2.3.1.n8; 3-keto acyl-CoA synthase ELOVL7 ELOVL fatty acid elongase 7; ELOVL FA elongase 7; ELOVL7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-281
Sequence
MAFSDLTSRTVRLYDNWIKDADPRVEDWLLMSSPLPQTIILGFYVYFVTSLGPKLMENRKPFELKKVMITYNFSIVLFSVYMFYEFIMSGWGTGYSFRCDIVDYSQSPTALRMVRTCWLYYFSKFIELLDTIFFILRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAVHVVMYSYYGLCALGPDYQKYLWWKKYLTSLQLIQFVLITIHISQFFFMEDCKYQFPVFQYIIMSYGCIFLLLFLHFWYRAYTKGQRLPKTVKHGICKNKDH
Sequence Length
281
Species
Bos taurus (Bovine)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,639 Da
NCBI Official Full Name
elongation of very long chain fatty acids protein 7
NCBI Official Synonym Full Names
ELOVL fatty acid elongase 7
NCBI Official Symbol
ELOVL7
NCBI Protein Information
elongation of very long chain fatty acids protein 7; ELOVL FA elongase 7; 3-keto acyl-CoA synthase ELOVL7; very-long-chain 3-oxoacyl-CoA synthase 7; ELOVL family member 7, elongation of long chain fatty acids
UniProt Protein Name
Elongation of very long chain fatty acids protein 7
Protein Family
UniProt Gene Name
ELOVL7
UniProt Synonym Gene Names
ELOVL FA elongase 7
UniProt Entry Name
ELOV7_BOVIN
Uniprot Description
Function: Condensing enzyme that catalyzes the synthesis of saturated and polyunsaturated very long chain fatty acids. Highest activity toward C18 acyl-CoAs
By similarity.
Catalytic activity: A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO2.
Subcellular location: Endoplasmic reticulum membrane; Multi-pass membrane protein
By similarity.
Domain: The di-lysine motif may confer endoplasmic reticulum localization
By similarity.
Sequence similarities: Belongs to the ELO family.
Similar Products
Product Notes
The ELOVL7 elovl7 (Catalog #AAA954914) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-281. The amino acid sequence is listed below: MAFSDLTSRT VRLYDNWIKD ADPRVEDWLL MSSPLPQTII LGFYVYFVTS LGPKLMENRK PFELKKVMIT YNFSIVLFSV YMFYEFIMSG WGTGYSFRCD IVDYSQSPTA LRMVRTCWLY YFSKFIELLD TIFFILRKKN SQVTFLHVFH HTIMPWTWWF GVKFAAGGLG TFHAFLNTAV HVVMYSYYGL CALGPDYQKY LWWKKYLTSL QLIQFVLITI HISQFFFMED CKYQFPVFQY IIMSYGCIFL LLFLHFWYRA YTKGQRLPKT VKHGICKNKD H. It is sometimes possible for the material contained within the vial of "Elongation of very long chain fatty acids protein 7 (ELOVL7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
