Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ETS domain-containing protein Elk-1 (Elk1) Recombinant Protein | Elk1 recombinant protein

Recombinant Mouse ETS domain-containing protein Elk-1 (Elk1)

Gene Names
Elk1; Elk-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ETS domain-containing protein Elk-1 (Elk1); Recombinant Mouse ETS domain-containing protein Elk-1 (Elk1); Elk1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-429, Full length protein
Sequence
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAIAMAPATVHAGPGDTATGKPGTPKGAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPQPPIPPRPASVLPNTTPAGVPAPASGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNQKSEELSLDPSFGHPQPPEVKVEGPKEELEAARAGGFSSEAVKAEPEVSASEGLLARLPAILTENTAQVCGLSTSTTEITQPQKGRKPRDLELPLSPSLLGGQGPERTPGSGTSSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP
Sequence Length
429
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Elk1 recombinant protein
This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. This protein is a nuclear target for the ras-raf-MAPK signaling cascade. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,271 Da
NCBI Official Full Name
ETS domain-containing protein Elk-1
NCBI Official Synonym Full Names
ELK1, member of ETS oncogene family
NCBI Official Symbol
Elk1
NCBI Official Synonym Symbols
Elk-1
NCBI Protein Information
ETS domain-containing protein Elk-1
UniProt Protein Name
ETS domain-containing protein Elk-1
UniProt Gene Name
Elk1

NCBI Description

This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. This gene may produce multiple isoforms by the use of alternative translational start codons. [provided by RefSeq, Mar 2012]

Uniprot Description

Transcription factor that binds to purine-rich DNA sequences. Forms a ternary complex with SRF and the ETS and SRF motifs of the serum response element (SRE) on the promoter region of immediate early genes such as FOS and IER2 (). Induces target gene transcription upon JNK-signaling pathway stimulation ().

Research Articles on Elk1

Similar Products

Product Notes

The Elk1 elk1 (Catalog #AAA966871) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-429, Full length protein. The amino acid sequence is listed below: MDPSVTLWQF LLQLLREQGN GHIISWTSRD GGEFKLVDAE EVARLWGLRK NKTNMNYDKL SRALRYYYDK NIIRKVSGQK FVYKFVSYPE VAGCSTEDCP PQPEVSVTSA IAMAPATVHA GPGDTATGKP GTPKGAGMTG QGGLARSSRN EYMRSGLYST FTIQSLQPQP QPPIPPRPAS VLPNTTPAGV PAPASGSRST SPNPLEACLE AEEAGLPLQV ILTPPEAPNQ KSEELSLDPS FGHPQPPEVK VEGPKEELEA ARAGGFSSEA VKAEPEVSAS EGLLARLPAI LTENTAQVCG LSTSTTEITQ PQKGRKPRDL ELPLSPSLLG GQGPERTPGS GTSSGLQAPG PALTPSLLPT HTLTPVLLTP SSLPPSIHFW STLSPIAPRS PAKLSFQFPS SGSAQVHIPS ISVDGLSTPV VLSPGPQKP. It is sometimes possible for the material contained within the vial of "ETS domain-containing protein Elk-1 (Elk1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.