ETS-related transcription factor Elf-3 (Elf3) Recombinant Protein | Elf3 recombinant protein
Recombinant Rat ETS-related transcription factor Elf-3 (Elf3)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ETS-related transcription factor Elf-3 (Elf3); Recombinant Rat ETS-related transcription factor Elf-3 (Elf3); Elf3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-395, full length protein
Sequence
MAATCEISNVFSNYFNAMYSSEDPTLAPAPLTTFGTEDFVLTLNNQHMSPEGPVGCVGPQTRSQRDRTEPPAVLHLAEKASWTGERPQFWSKTQVLDWISYQVEKNKYDASSIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMTFQEGLGDSGPFDQGSPFAQELLDDGRQASPYYGSSYGPGAPSPGSSDFSTSGTDTPQSSHSSDSGGSDVDLDLTDSKVFPRDGFPDYKKGEPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVGESQN
Sequence Length
395
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,521 Da
NCBI Official Full Name
ETS-related transcription factor Elf-3
NCBI Official Synonym Full Names
E74 like ETS transcription factor 3
NCBI Official Symbol
Elf3
NCBI Protein Information
ETS-related transcription factor Elf-3
UniProt Protein Name
ETS-related transcription factor Elf-3
Protein Family
UniProt Gene Name
Elf3
Uniprot Description
Transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter. Also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Represses KRT4 promoter activity. Involved in mediating vascular inflammation. May play an important role in epithelial cell differentiation and tumorigenesis. May be a critical downstream effector of the ERBB2 signaling pathway. May be associated with mammary gland development and involution. Plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development ().
Similar Products
Product Notes
The Elf3 elf3 (Catalog #AAA1310626) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-395, full length protein. The amino acid sequence is listed below: MAATCEISNV FSNYFNAMYS SEDPTLAPAP LTTFGTEDFV LTLNNQHMSP EGPVGCVGPQ TRSQRDRTEP PAVLHLAEKA SWTGERPQFW SKTQVLDWIS YQVEKNKYDA SSIDFSRCDM DGATLCNCAL EELRLVFGPL GDQLHAQLRD LTSSSSDELS WIIELLEKDG MTFQEGLGDS GPFDQGSPFA QELLDDGRQA SPYYGSSYGP GAPSPGSSDF STSGTDTPQS SHSSDSGGSD VDLDLTDSKV FPRDGFPDYK KGEPKHGKRK RGRPRKLSKE YWDCLEGKKS KHAPRGTHLW EFIRDILIHP ELNEGLMKWE NRHEGVFKFL RSEAVAQLWG QKKKNSNMTY EKLSRAMRYY YKREILERVD GRRLVYKFGK NSSGWKEEEV GESQN. It is sometimes possible for the material contained within the vial of "ETS-related transcription factor Elf-3 (Elf3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
