Eukaryotic translation initiation factor 4H (Eif4h) Recombinant Protein | Eif4h recombinant protein
Recombinant Rat Eukaryotic translation initiation factor 4H (Eif4h)
Gene Names
Eif4h; Wbscr1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Eukaryotic translation initiation factor 4H (Eif4h); Recombinant Rat Eukaryotic translation initiation factor 4H (Eif4h); Eif4h recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-248, full length protein
Sequence
ADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGGSREPRGGWDSRDDFSSGYRDDFLGGRGGSRPGDRRAGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE
Sequence Length
247
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Eif4h recombinant protein
This gene encodes one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,324 Da
NCBI Official Full Name
eukaryotic translation initiation factor 4H
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4H
NCBI Official Symbol
Eif4h
NCBI Official Synonym Symbols
Wbscr1
NCBI Protein Information
eukaryotic translation initiation factor 4H
UniProt Protein Name
Eukaryotic translation initiation factor 4H
Protein Family
UniProt Gene Name
Eif4h
UniProt Synonym Gene Names
Wbscr1; eIF-4H
Uniprot Description
Stimulates the RNA helicase activity of EIF4A in the translation initiation complex. Binds weakly mRNA ().
Similar Products
Product Notes
The Eif4h eif4h (Catalog #AAA1437759) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-248, full length protein. The amino acid sequence is listed below: ADFDTYDDRA YSSFGGGRGS RGSAGGHGSR SQKELPTEPP YTAYVGNLPF NTVQGDIDAI FKDLSIRSVR LVRDKDTDKF KGFCYVEFDE VDSLKEALTY DGALLGDRSL RVDIAEGRKQ DKGGFGFRKG GPDDRGMGGS REPRGGWDSR DDFSSGYRDD FLGGRGGSRP GDRRAGPPMG SRFRDGPPLR GSNMDFREPT EEERAQRPRL QLKPRTVATP LNQVANPNSA IFGGARPREE VVQKEQE. It is sometimes possible for the material contained within the vial of "Eukaryotic translation initiation factor 4H (Eif4h), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
