Eukaryotic translation initiation factor 4E-binding protein 2 (Eif4ebp2) Recombinant Protein | Eif4ebp2 recombinant protein
Recombinant Mouse Eukaryotic translation initiation factor 4E-binding protein 2 (Eif4ebp2)
Gene Names
Eif4ebp2; 4E-BP2; PHAS-II; AA792569; BC010348; 2810011I19Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Eukaryotic translation initiation factor 4E-binding protein 2 (Eif4ebp2); Recombinant Mouse Eukaryotic translation initiation factor 4E-binding protein 2 (Eif4ebp2); Eif4ebp2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-120, Full length protein
Sequence
MSASAGGSHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI
Sequence Length
120
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Eif4ebp2 recombinant protein
This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,898 Da
NCBI Official Full Name
eukaryotic translation initiation factor 4E-binding protein 2
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4E binding protein 2
NCBI Official Symbol
Eif4ebp2
NCBI Official Synonym Symbols
4E-BP2; PHAS-II; AA792569; BC010348; 2810011I19Rik
NCBI Protein Information
eukaryotic translation initiation factor 4E-binding protein 2
UniProt Protein Name
Eukaryotic translation initiation factor 4E-binding protein 2
Protein Family
UniProt Gene Name
Eif4ebp2
UniProt Synonym Gene Names
PHAS-II
Uniprot Description
Repressor of translation initiation involved in synaptic plasticity, learning and memory formation (PubMed:16237163, PubMed:17029989). Regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation (PubMed:17029989, PubMed:20347422, PubMed:23172145). EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal stem cell renewal via its ability to repress translation initiation (PubMed:20347422, PubMed:24139800, PubMed:23172145). Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways (PubMed:8939971).
Research Articles on Eif4ebp2
Similar Products
Product Notes
The Eif4ebp2 eif4ebp2 (Catalog #AAA948415) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-120, Full length protein. The amino acid sequence is listed below: MSASAGGSHQ PSQSRAIPTR TVAISDAAQL PQDYCTTPGG TLFSTTPGGT RIIYDRKFLL DRRNSPMAQT PPCHLPNIPG VTSPGALIED SKVEVNNLNN LNNHDRKHAV GDEAQFEMDI. It is sometimes possible for the material contained within the vial of "Eukaryotic translation initiation factor 4E-binding protein 2 (Eif4ebp2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
