Putative eukaryotic translation initiation factor 4E-4 (At1g29550) Recombinant Protein | At1g29550 recombinant protein
Recombinant Arabidopsis thaliana Putative eukaryotic translation initiation factor 4E-4 (At1g29550)
Gene Names
AT1G29550; EIF4E1B; F15D2.13; F15D2_13
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Putative eukaryotic translation initiation factor 4E-4 (At1g29550); Recombinant Arabidopsis thaliana Putative eukaryotic translation initiation factor 4E-4 (At1g29550); At1g29550 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-240, Full length protein
Sequence
MVVTDSPVSGIMADQNIDPNTTTSPSPKEKHVSAIKAISGDEKAPSKEKKNYASKKSTTVIQKSHCFQNSWTFWFDNPSSKSNQVIWGSSLRSLYTFGTIEEFWSLYNNIHPPTKWVSGADLYCFKDKIEPKWEDPICANGGKWSMMFPKATLECNWLNTLLALVGEQFDQGDEICGAVLNFRARGDRISLWTKNAANEEAQLSIGKQWKELLGYNETIGFIVHEDAKTLDRDAKRRYTV
Sequence Length
240
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,141 Da
NCBI Official Full Name
Eukaryotic initiation factor 4E protein
NCBI Official Symbol
AT1G29550
NCBI Official Synonym Symbols
EIF4E1B; F15D2.13; F15D2_13
NCBI Protein Information
Eukaryotic initiation factor 4E protein
UniProt Protein Name
Eukaryotic translation initiation factor 4E-3
UniProt Gene Name
EIF4E3
Uniprot Description
Component of the protein complex eIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure and recruitment of mRNA to the ribosome. Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures ().
Research Articles on At1g29550
Similar Products
Product Notes
The At1g29550 eif4e3 (Catalog #AAA1336488) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-240, Full length protein. The amino acid sequence is listed below: MVVTDSPVSG IMADQNIDPN TTTSPSPKEK HVSAIKAISG DEKAPSKEKK NYASKKSTTV IQKSHCFQNS WTFWFDNPSS KSNQVIWGSS LRSLYTFGTI EEFWSLYNNI HPPTKWVSGA DLYCFKDKIE PKWEDPICAN GGKWSMMFPK ATLECNWLNT LLALVGEQFD QGDEICGAVL NFRARGDRIS LWTKNAANEE AQLSIGKQWK ELLGYNETIG FIVHEDAKTL DRDAKRRYTV. It is sometimes possible for the material contained within the vial of "Putative eukaryotic translation initiation factor 4E-4 (At1g29550), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
