Eukaryotic translation initiation factor 4E type 2 (EIF4E2) Recombinant Protein | EIF4E2 recombinant protein
Recombinant Human Eukaryotic translation initiation factor 4E type 2 (EIF4E2)
Gene Names
EIF4E2; 4EHP; IF4e; 4E-LP; h4EHP; EIF4EL3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Eukaryotic translation initiation factor 4E type 2 (EIF4E2); Recombinant Human Eukaryotic translation initiation factor 4E type 2 (EIF4E2); EIF4E2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-245, Full length protein
Sequence
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
Sequence Length
245
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,026 Da
NCBI Official Full Name
eukaryotic translation initiation factor 4E type 2 isoform C
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4E family member 2
NCBI Official Symbol
EIF4E2
NCBI Official Synonym Symbols
4EHP; IF4e; 4E-LP; h4EHP; EIF4EL3
NCBI Protein Information
eukaryotic translation initiation factor 4E type 2
UniProt Protein Name
Eukaryotic translation initiation factor 4E type 2
Protein Family
UniProt Gene Name
EIF4E2
UniProt Synonym Gene Names
EIF4EL3; eIF-4E type 2; eIF4E type 2; h4EHP
Uniprot Description
Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation (PubMed:9582349, PubMed:17368478, PubMed:25624349). Acts as a repressor of translation initiation (PubMed:22751931). In contrast to EIF4E, it is unable to bind eIF4G (EIF4G1, EIF4G2 or EIF4G3), suggesting that it acts by competing with EIF4E and block assembly of eIF4F at the cap ().
Research Articles on EIF4E2
Similar Products
Product Notes
The EIF4E2 eif4e2 (Catalog #AAA1154639) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-245, Full length protein. The amino acid sequence is listed below: MNNKFDALKD DDSGDHDQNE ENSTQKDGEK EKTERDKNQS SSKRKAVVPG PAEHPLQYNY TFWYSRRTPG RPTSSQSYEQ NIKQIGTFAS VEQFWRFYSH MVRPGDLTGH SDFHLFKEGI KPMWEDDANK NGGKWIIRLR KGLASRCWEN LILAMLGEQF MVGEEICGAV VSVRFQEDII SIWNKTASDQ ATTARIRDTL RRVLNLPPNT IMEYKTHTDS IKMPGRLGPQ RLLFQNLWKP RLNVP. It is sometimes possible for the material contained within the vial of "Eukaryotic translation initiation factor 4E type 2 (EIF4E2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
