Eukaryotic translation initiation factor 3 subunit M (EIF3M) Recombinant Protein | EIF3M recombinant protein

Recombinant Human Eukaryotic translation initiation factor 3 subunit M (EIF3M)

Cat. Num. AAA1464511

• Gene Names: EIF3M; B5; GA17; PCID1; TANGO7; hfl-B5
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Eukaryotic translation initiation factor 3 subunit M (EIF3M); Recombinant Human Eukaryotic translation initiation factor 3 subunit M (EIF3M); Eukaryotic translation initiation factor 3 subunit M; eIF3m; Fetal lung protein B5; hFL-B5; PCI domain-containing protein 1; EIF3M recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-374aa; Full Length of Mature Protein
• Sequence: SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT
• Sequence Length: 373

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-Page

Related Product Information for EIF3M recombinant protein

Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. May favor virus entry in case of infection with herpes simplex virus 1 (HSV1) or herpes simplex virus 2 (HSV2).

NCBI and Uniprot Product Information

• NCBI GI #: 23397429
• NCBI GeneID: 10480
• NCBI Accession #: NP_006351.2
• NCBI GenBank Nucleotide #: NM_006360.4
• UniProt Accession #: Q7L2H7; O60735; Q2F836; Q53HL6; Q9BXW1; A8K7X4
• Molecular Weight: 58.4 kDa
• NCBI Official Full Name: eukaryotic translation initiation factor 3 subunit M
• NCBI Official Synonym Full Names: eukaryotic translation initiation factor 3, subunit M
• NCBI Official Symbol: EIF3M
• NCBI Official Synonym Symbols: B5; GA17; PCID1; TANGO7; hfl-B5
• NCBI Protein Information: eukaryotic translation initiation factor 3 subunit M; B5 receptor; fetal lung protein B5; dendritic cell protein; PCI domain-containing protein 1; transport and golgi organization 7 homolog; PCI domain containing 1 (herpesvirus entry mediator)
• UniProt Protein Name: Eukaryotic translation initiation factor 3 subunit M
• Protein Family: Eukaryotic translation initiation factor
• UniProt Gene Name: EIF3M
• UniProt Synonym Gene Names: hFL-B5
• UniProt Entry Name: EIF3M_HUMAN

NCBI Description

This gene encodes a protein that is part of the eurkaryotic translation initiation factor 3 complete (eIF-3) required for protein synthesis. Elevated levels of the encoded protein are present in cancer cell lines. Inactivation of the encoded protein has been shown to interfere with translation of herpes virus mRNAs by preventing the association of mRNAs with the ribosomes. A pseudogene of this gene is located on the X chromosome. [provided by RefSeq, Dec 2011]

Uniprot Description

EIF3M: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. May favor virus entry in case of infection with herpes simplex virus 1 (HSV1) or herpes simplex virus 2 (HSV2). Belongs to the eIF-3 subunit M family.

Protein type: Translation initiation

Chromosomal Location of Human Ortholog: 11p13

Cellular Component: eukaryotic translation initiation factor 3 complex

Molecular Function: protein binding; translation initiation factor binding; translation initiation factor activity

Biological Process: translational initiation; formation of translation preinitiation complex; regulation of translational initiation