Eukaryotic translation initiation factor 3 subunit F (EIF3F) Recombinant Protein | EIF3F recombinant protein

Recombinant Human Eukaryotic translation initiation factor 3 subunit F (EIF3F), partial

Cat. Num. AAA717123

• Gene Names: EIF3F; EIF3S5; eIF3-p47
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Eukaryotic translation initiation factor 3 subunit F (EIF3F); Recombinant Human Eukaryotic translation initiation factor 3 subunit F (EIF3F); partial; Deubiquitinating enzyme eIF3f (EC:3.4.19.12); EIF3F recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-323aa, Partial
• Sequence: MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDF

• Species: Homo sapiens (Human)
• Subcellular Location: Cytoplasm
• Protein Families: EIF-3 subunit F family
• Relevance: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassbly and recycling of post-termination ribosomal complexes and subsequently prevents prature joining of the 40S and 60S ribosomal subunits prior to initiation.
• Function: Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

Product Categories/Family for EIF3F recombinant protein

Metabolism

References

Structure of cDNAs encoding human eukaryotic initiation factor 3 subunits. Possible roles in RNA binding and macromolecular assembly.Asano K., Vornlocher H.-P., Richter-Cook N.J., Merrick W.C., Hinnebusch A.G., Hershey J.W.B.J. Biol. Chem. 272:27042-27052(1997)
https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:3275
https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=516023
https://www.genome.jp/dbget-bin/www_bget?hsa:8665
https://string-db.org/network/9606.ENSP00000310040
https://www.omim.org/entry/603914603914603914

NCBI and Uniprot Product Information

• NCBI GI #: 4503519
• NCBI GeneID: 8665
• NCBI Accession #: NP_003745.1
• NCBI GenBank Nucleotide #: NM_003754.2
• UniProt Accession #: O00303; Q6IB45; Q8N978; A8K0S2
• Molecular Weight: 37,564 Da
• NCBI Official Full Name: eukaryotic translation initiation factor 3 subunit F
• NCBI Official Synonym Full Names: eukaryotic translation initiation factor 3, subunit F
• NCBI Official Symbol: EIF3F
• NCBI Official Synonym Symbols: EIF3S5; eIF3-p47
• NCBI Protein Information: eukaryotic translation initiation factor 3 subunit F; eIF3-epsilon; eIF-3-epsilon; deubiquitinating enzyme eIF3f; eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa
• UniProt Protein Name: Eukaryotic translation initiation factor 3 subunit F
• Protein Family: Eukaryotic translation initiation factor
• UniProt Gene Name: EIF3F
• UniProt Entry Name: EIF3F_HUMAN

Uniprot Description

eIF3-epsilon: eukaryotic translation initiation factor 3, subunit 5 epsilon. Binds to the 40s ribosome and promotes the binding of methionyl-tRNAi and mRNA. Associates with the complex p170-eIF3. eIF-3 is composed of at least 12 different subunits.

Protein type: Translation; Translation initiation; EC 3.4.19.12

Chromosomal Location of Human Ortholog: 11p15.4

Cellular Component: eukaryotic translation initiation factor 3 complex; membrane; cytosol

Molecular Function: protein binding; translation initiation factor binding; translation initiation factor activity; ubiquitin-specific protease activity

Biological Process: protein deubiquitination; cellular protein metabolic process; translation; translational initiation; gene expression; proteolysis; formation of translation preinitiation complex; regulation of translational initiation