Translation initiation factor eIF-2B subunit delta (Eif2b4) Recombinant Protein | Eif2b4 recombinant protein
Recombinant Rat Translation initiation factor eIF-2B subunit delta (Eif2b4)
Gene Names
Eif2b4; Eif2b
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Translation initiation factor eIF-2B subunit delta (Eif2b4); Recombinant Rat Translation initiation factor eIF-2B subunit delta (Eif2b4); Eif2b4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-524, full length protein
Sequence
AAVAVAVREESRSEMKTELSPRPGAAGRELTQEEKLQLRKEKKQQKKKRKEEKGADQEIGSAVSAAQRQDPVRELQGTGSQLGGTTGEKLPAGRSKAELRAERRAKQEAERALKQARKGEQGGPSPQACPSTAGEATSGVKRVPEHTQADDPTLLRRLLRKPDRQQVPTRKDYGSKVSLFSHLPQYSRQSSLTQYMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLHALQQVIQDYTTPPNEELSRDLVNKLKPYISFLTQCRPMSASMCNAIKFFNKEVTGMSSSKREEEAKSELKEAIDRYVQEKIVLASQAISRFASKKISDGDVILVYGCSSLVSRILQEAWVEGRRFRVVVVDSRPRLEGRHMLHCLVRAGVPTSYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGTAQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGDQVTLANWQNNSSLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
Sequence Length
523
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Eif2b4 recombinant protein
Eukaryotic initiation factor 2B (EIF2B), which is necessary for protein synthesis, is a GTP exchange factor composed of five different subunits. This protein is the fourth, or delta, subunit. Defects in this gene are a cause of leukoencephalopathy with vanishing white matter (VWM) and ovarioleukodystrophy. Multiple transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,809 Da
NCBI Official Full Name
translation initiation factor eIF-2B subunit delta
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 2B subunit delta
NCBI Official Symbol
Eif2b4
NCBI Official Synonym Symbols
Eif2b
NCBI Protein Information
translation initiation factor eIF-2B subunit delta
UniProt Protein Name
Translation initiation factor eIF-2B subunit delta
Protein Family
UniProt Gene Name
Eif2b4
UniProt Synonym Gene Names
Eif2bd
NCBI Description
mediates the exchange of GDP bound to translation initiation factor eIF2 for GTP [RGD, Feb 2006]
Uniprot Description
Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
Research Articles on Eif2b4
Similar Products
Product Notes
The Eif2b4 eif2b4 (Catalog #AAA1448935) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-524, full length protein. The amino acid sequence is listed below: AAVAVAVREE SRSEMKTELS PRPGAAGREL TQEEKLQLRK EKKQQKKKRK EEKGADQEIG SAVSAAQRQD PVRELQGTGS QLGGTTGEKL PAGRSKAELR AERRAKQEAE RALKQARKGE QGGPSPQACP STAGEATSGV KRVPEHTQAD DPTLLRRLLR KPDRQQVPTR KDYGSKVSLF SHLPQYSRQS SLTQYMSIPS SVIHPAMVRL GLQYSQGLVS GSNARCIALL HALQQVIQDY TTPPNEELSR DLVNKLKPYI SFLTQCRPMS ASMCNAIKFF NKEVTGMSSS KREEEAKSEL KEAIDRYVQE KIVLASQAIS RFASKKISDG DVILVYGCSS LVSRILQEAW VEGRRFRVVV VDSRPRLEGR HMLHCLVRAG VPTSYLLIPA ASYVLPEVSK VLLGAHALLA NGSVMSRVGT AQLALVARAH NVPVLVCCET YKFCERVQTD AFVSNELDDP DDLQCKRGDQ VTLANWQNNS SLRLLNLVYD VTPPELVDLV ITELGMIPCS SVPVVLRVKS SDQ. It is sometimes possible for the material contained within the vial of "Translation initiation factor eIF-2B subunit delta (Eif2b4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
